ESTScan Details for Unigene SGN-U337453

Score 
394
Direction 
Forward
Predicted Peptide Sequence 
MEPSSSSPEFDYLFKLLLIADSGVGKSNLLLTFTSDAFEDLSPSIVVDFNEQPVSLGGKKLKLAIWYTTGLEIFRTLSSSSYRGAHGIIM
VYDVTRRYTFTNLSDIWVTEFDLYSTNPECIQMLVCNKVDTESAQGFPKKQAIDFATEYGCLFIQRTAHTRVHVHHCFEELVLQNFDTPP
LLAEGFTCRPATLFSHPNLRNLDASPXLTPSPQRTSPXLSFPLFPLPIDTTTPCPPLATLTTSCFHSLPHSYSPLTPTIPSCRPXRAPNF
YPLTETYYKHLILRAXPTLPPFFPLQAHALIHPRLASIQAIPYLP
Predicted Coding Sequence 
ATGGAACCGTCTTCCTCTTCTCCGGAGTTTGATTACTTGTTTAAGCTGTTGTTGATTGCAGATTCAGGAGTAGGGAAGAGTAATTTGTTG
CTCACTTTCACTTCTGATGCCTTTGAGGATCTTTCTCCATCTATTGTTGTGGACTTCAACGAACAACCTGTCTCCCTCGGGGGGAAGAAG
TTGAAACTTGCTATCTGGTATACAACTGGACTGGAAATATTTAGGACTTTATCGAGTTCATCCTACCGAGGAGCTCACGGAATAATCATG
GTTTATGATGTTACAAGGCGATACACATTTACTAATCTCTCTGATATATGGGTCACAGAATTCGACCTGTACTCAACAAATCCGGAGTGC
ATCCAGATGCTTGTCTGCAACAAAGTTGATACGGAAAGTGCTCAGGGTTTCCCCAAAAAACAGGCAATTGATTTCGCCACGGAATATGGA
TGTCTTTTCATCCAACGCACTGCACACACGAGGGTTCATGTGCACCACTGCTTTGAGGAGCTTGTCCTGCAAAATTTTGACACTCCACCT
CTCTTGGCTGAAGGGTTCACCTGCCGTCCGGCAACACTTTTTTCTCACCCAAACCTCCGGAATCTCGATGCTTCACCAAAXCTGACTCCT
TCTCCACAACGAACCTCCCCTCXGCTTTCCTTCCCCCTATTCCCCCTTCCTATTGACACCACAACCCCATGCCCACCTCTTGCCACACTC
ACTACCTCCTGTTTCCACTCCCTTCCCCACTCCTACTCTCCATTGACCCCAACTATTCCTTCATGTCGCCCCCXCCGCGCCCCTAACTTT
TACCCTTTGACCGAAACATACTATAAACACCTCATCCTCCGGGCGGXGCCCACCCTACCCCCATTTTTCCCCTTACAAGCCCACGCCCTC
ATACACCCTCGCCTCGCCTCGATTCAAGCCATCCCCTATCTACCATAA
Edits in Original Sequence 
CCCATTTATAGTTTTTTTTTGAATCTGTGTTTATTGATTGTTGCTCTGAATTTTATTTTTTTTGGATCTTAAGGTTTTTTAGGTACATTG
AGTATCTGGGTATAACTGGAAATTTGAAATTGTTGGAAGGTTTTTGAGAAAATGGAACCGTCTTCCTCTTCTCCGGAGTTTGATTACTTG
TTTAAGCTGTTGTTGATTG
(5')ATGGAACCGTCTTCCTCTTCTCCGGAGTTTGATTACTTGTTTAAGCTGTTGTTGATTGCAGATTCAG
GAGTAGGGAAGAGTAATTTGTTGCTCACTTTCACTTCTGATGCCTTTGAGGATCTTTCTCCATCTATTGTTGTGGACTTCAACGAACAAC
CTGTCTCCCTCGGGGGGAAGAAGTTGAAACTTGCTATCTGGTATACAACTGGACTGGAAATATTTAGGACTTTATCGAGTTCATCCTACC
GAGGAGCTCACGGAATAATCATGGTTTATGATGTTACAAGGCGATACACATTTACTAATCTCTCTGATATATGGGTCACAGAATTCGACC
TGTACTCAACAAATCCGGAGTGCATCCAGATGCTTGTCTGCAACAAAGTTGATACGGAAAGTGCTCAGGGTTgTCCCCAAAAAACAGGCA
ATTGATTTCGCCACGGAATATGGATGTCTTTTCATCCAACGCACTGCACACACGAGGGTTCATGTGCgACCACTGCTTTGAGGAGCTTGT
CCTGCAAAATTTTGACACTCCACCTCTCTTGGCTGAAGGGTTCACCTGCCGTCCGGCAACACTTTTTTCTCACCCAAACCTCCGGAATCT
CGATGCTTCACCAAAXCTGACTCCTTCTCCACAACGAACCTCCCCTCXGCTTTCCTTCCCCCTATTCCCCCTTCCTATTGACACCACAAC
CCgCATGCCCACCTCTTGCCACACTCACTACCTCCTGTTTCCACTCCCTTCCCCACTCCTACTCTCCATTGACCCCAACTATTCCTTCAT
GTCGCCCCCXCCGCGCCCCTAACTTTTACCCTTTGACCGAAACATACTATAAACACCTCATCCTCCGGGCGGXGCCCACCCTACCCCCAT
TTTTCCCCTTACAAGCCCACGCCCTCATACACCCTCGCCTCGCCTCGATTCAAGCCATCCCCTATCTACCATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan