Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U337457

Score 
634
Direction 
Forward
Predicted Peptide Sequence 
TKIKDLRGGRLKTVDPRAAGIRHERFPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNVLLF
DDDVAKIADFDLSNQAPDMAARLHSTRALGTFGYHAPEYAMTGHLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQTLVTWATPRLSED
KVKQCVDARLGTDYPPKAIAKMAAVAASVCAIRKLIFXPKMSIVVKAPPTSFAPLDPAPVKPSNLGFSPLPAPATKWNDRESETRPREFK
KKSTTQ
Predicted Coding Sequence 
XCTACCAAAATAAAGGACCTCCGCGGCGGCCGCCTTAAAACTGTGGATCCCCGGGCTGCAGGAATTCGGCACGAGCGCTTCCCCAATGGA
TCTCTCCATGACATTCTTCATGGACGAAAAGGTGTGAAAGGTGCACAGCCAGGTCCAGTATTATCATGGGCCCAACGGGTTAAAATTGCC
GTTGGAGCTGCAAAAGGGCTAGAGTACTTGCATGAAAAAGCACAACCACATATTATCCATCGAGATATTAAGTCTAGCAATGTCCTACTC
TTTGATGATGATGTTGCTAAGATTGCGGATTTTGATTTATCAAATCAAGCTCCTGATATGGCAGCACGCCTTCACTCCACACGTGCTCTT
GGAACCTTTGGTTATCATGCTCCTGAATATGCAATGACTGGTCACCTGAGTTCAAAGAGTGATGTTTACAGCTTTGGTGTTGTCCTCCTT
GAACTACTCACTGGTCGTAAACCTGTTGATCATACATTACCACGTGGCCAACAGACTCTTGTGACATGGGCAACACCGAGACTTAGTGAA
GATAAAGTGAAGCAATGTGTTGACGCTAGACTCGGTACAGATTACCCTCCTAAGGCCATTGCAAAGATGGCTGCTGTTGCTGCCTCTGTG
TGTGCAATACGCAAGCTGATTTTCXGGCCAAAAATGAGCATTGTGGTAAAAGCTCCTCCAACCTCTTTTGCACCCCTCGACCCTGCACCA
GTGAAACCTTCAAACTTGGGATTCTCTCCTTTGCCCGCACCCGCTACCAAATGGAATGACCGCGAATCXGAGACTCGTCCTCGTGAGTTC
AAAAAGAAATCTACAACCCAGTAA
Edits in Original Sequence 
(5')XCTACCAAAATAAAGGACCTCCGCgGGCGGCCGCCTTAAAACTGTGGATCCCCGGGCTGCAGGAATTCGGCACGAGCGCTTCCCCA
ATGGATCTCTCCATGACATTCTTCATGGACGAAAAGGTGTGAAAGGTGCACAGCCAGGTCCAGTATTATCATGGGCCCAACGGGTTAAAA
TTGCCGTTGGAGCTGCAAAAGGGCTAGAGTACTTGCATGAAAAAGCACAACCACATATTATCCATCGAGATATTAAGTCTAGCAATGTCC
TACTCTTTGATGATGATGTTGCTAAGATTGCGGATTTTGATTTATCAAATCAAGCTCCTGATATGGCAGCACGCCTTCACTCCACACGTG
CTCTTGGAACCTTTGGTTATCATGCTCCTGAATATGCAATGACTGGTCACCTGAGTTCAAAGAGTGATGTTTACAGCTTTGGTGTTGTCC
TCCTTGAACTACTCACTGGTCGTAAACCTGTTGATCATACATTACCACGTGGCCAACAGACTCTTGTGACATGGGCAACACCGAGACTTA
GTGAAGATAAAGTGAAGCAATGTGTTGACGCTAGACTCGGTACAGATTACCCTCCTAAGGCCATTGCAAAGATGGCTGcCTGTTGCTGCC
TCTGTGTGTGCAATACGCAAGCTGATTTTCXGGCCAAAAATGAGCATTGTGGTAAAAGCTCCTCCAACCTCTTTTGCACCCCTCGACCCT
GCACCtAGTGAAACCTTCAAACTTGGGATTCTCTCCTTTGCCCGCACCCGCTACCAAATGGAATGACCGCGAATCXGAGACTCGTCCTCG
TGAGTTCAAAAAGAAATCTACAACCCAGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan