Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U337482

Score 
562
Direction 
Forward
Predicted Peptide Sequence 
MGSLTVTHKLPVIDFTMENLEPGTNSWSKASKEAVCALEEYGCFVALYDKVSSKIHDDVFQAXIKVVDLPTQKKRHNKCSKPLYGYVGQN
PFIPLYESVGIDNAHTLESIRNFTNFMWPKGNNDYSEALVAYSKRACAIRRNGGENGFENYGGEKYYESHFNPELSFSSXEIFRNPHLKI
KTGDLVLITDKKLYVHQFLRLIQFYGVWRTKGKEWPWV
Predicted Coding Sequence 
ATGGGTTCTCTAACAGTTACCCACAAACTTCCTGTTATTGATTTCACCATGGAGAATTTGGAACCAGGTACAAATTCATGGTCCAAAGCA
AGTAAAGAAGCTGTCTGTGCTCTTGAAGAGTATGGTTGTTTTGTAGCATTATATGATAAAGTCTCATCAAAGATCCATGATGATGTTTTT
CAAGCAXCTATAAAAGTTGTTGATCTTCCAACTCAGAAAAAAAGGCACAATAAGTGTAGTAAACCTTTGTATGGGTATGTTGGCCAAAAT
CCATTTATTCCTCTTTATGAGAGCGTGGGCATTGATAATGCTCATACACTTGAAAGCATCCGAAATTTCACCAATTTCATGTGGCCTAAA
GGAAACAATGATTATAGCGAAGCATTGGTAGCCTACTCCAAAAGGGCCTGTGCAATTAGAAGAAATGGTGGTGAAAATGGTTTTGAGAAC
TATGGTGGTGAAAAATACTATGAATCACATTTCAATCCGGAATTATCTTTCTCGAGTNATGAAATTTTTAGAAACCCACATTTAAAAATC
AAAACTGGGGATTTGGTGCTTATAACAGACAAGAAGCTTTATGTCCACCAATTTCTTCGACTTATTCAGTTTTATGGGGTTTGGAGAACA
AAAGGGAAAGAATGGCCCTGGGTTTAA
Edits in Original Sequence 
TCGAGGAATAGACAAAAAAAAAAGTAATTAAAAAAGATCCATGGGTTCTCTAACAGTTACCCACAAACTTCCTGTTATTGATTTCACCAT
GGAGAATTTGGAACCAGGTACAAATT
(5')ATGGGTTCTCTAACAGTTACCCACAAACTTCCTGTTATTGATTTCACCATGGAGAATTTG
GAACCAGGTACAAATTCATGGTCCAAAGCAAGTAAAGAAGCTGTCTGTGCTCTTGAAGAGTATGGTTGTTTTGTAGCATTATATGATAAA
GTCTCATCAAAGATCCATGATGATGTTTTTCAAGCAXCTATAAAAGTTGtTTGATCTTCCAACTCAGAAAAAAAGGCACAATAAGTGTAG
TAAACCTTTGTATGGGTATGTTGGCCAAAATCCATTTATTCCTCTTTATGAGAGCGTGGGCATTGATAATGCTCATACACTTGAAAGCAT
CCGAAATTTCACCAATTTCATGTGGCCTAAAGGAAACAATGATTATAGCGAAGCATTGGTAGCCTACTCCAAAAGGGCCTGTGCAATTAG
AAGAAATGGTGGTGAAAATGGtTTTTGAGAACTATGGTGGTGAAAAATACTATGAATCACATaTTCAATCCGGAATTATCTTTCTCGAGT
NATGAAATTTTTAGAAACCCACATTTAAAAATCAAAACTGGGGATTTGGTGCTTATAACAGACAAGAAGCTTTATGTCCACCAATTTCTT
CGACTTATTCAGTTTTATGGGGTTTGGAGAACAAAAGGGAAAGAATGGCCCTGGGTTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan