ESTScan Details for Unigene SGN-U337511

Score 
280
Direction 
Forward
Predicted Peptide Sequence 
MGVLCFCLRVYTTDIDPQQQKVIVTGNDEADTXDTKLIRNGRSADLWPEPKPILKVDKLRIIAYSEDYDDDQEDDEHNNHNTEKPAEHDP
SRHGVQVWAAETFTMDVKEITIDDRPSEKINVVEKLPXAGTKCCGGEDLSNDKX
Predicted Coding Sequence 
ATGGGTGTTTTGTGTTTTTGTTTACGTGTTTATACTACGGATATTGATCCACAACAACAGAAAGTTATAGTGACTGGAAATGATGAAGCT
GACACTXTTGATACAAAACTGATAAGGAATGGAAGAAGTGCTGATTTATGGCCAGAGCCGAAGCCTATATTAAAAGTAGATAAACTAAGG
ATCATTGCTTACAGCGAAGACTACGATGATGATCAAGAGGATGATGAACATAATAATCATAATACTGAAAAACCTGCTGAACATGATCCA
TCAAGACATGGTGTGCAGGTTTGGGCGGCTGAGACTTTTACGATGGATGTCAAAGAAATAACGATAGATGATAGGCCTTCGGAAAAAATC
AACGTCGTTGAAAAGTTACCCGXCGCCGGAACAAAATGCTGCGGCGGTGAAGACCTATCAAATGACAAAAXX
Edits in Original Sequence 
GATACTTCCTATCTTTCATTCTTATGGCATCCTCTCCACCTGATCAAGAACAACAACCACCTCAATTTCCTCCACTTCACTACAGGGTCA
TATCTTTTTAATTTATATTCATTACTCTTTCAAGTTCCCTTTTTTGATATTTTTTTATACTTAACATATCTGTTTTTCATTATTTTTTTC
AGACATGGGTTTTGAAAGTTTCCATCCATTGTCCAGGCTGCTAGAGAAAAGTCAAGAAAGTCTTGCAGAGCATTGAAGGTTCGTTTACTT
TTCTCCTCTCCTCTCATGTAATCTGCATGTATATATGTTCTCTCCATAGGTATAAATTTAAAATATGATCACTTGAAATTGCTATTGTAA
AATTCAGAACCTATGCATATCTATATCTAATCAATTATGGGTGTTTTGTGTTTTTGTTTACGTGTTTATACTACGGATATTGATCCACAA
CAACAGAAAGTTATAGTGA
(5')ATGGGTGTTTTGTGTTTTTGTTTACGTGTTTATACTACGGATATTGATCCACAACAACAGAAAGTTA
TAGTGACTGGAAATGATGAAGCTGACACTXTTGATACAAAACTGATAAGGAATGGAAGAAGTGCTGATTTATGGCCAGAGCCGAAGCCTA
TATTAAAAGTAGATAAACTAAGGATCATTGCTTACAGCGAAGACTACGATGATGATCAAGAGGATGATGAACATAATAATCATAATACTG
AAAAACCTGCTGAACATGATCCATCAAGACATGGTGTGCAGGTTTGGcGCGGCTGAGACTTTTACGATGGATGTCAAAGAAATAACGATA
GATGATAGGCCTTCGGAAAAAATCAACGTCGTTGAAAAGTTACCCGXCGCCGGAACAAAATGCTGCGGCGGTGtAAGACCTATCAAATGA
CAAAAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan