Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U337524

Score 
68
Direction 
Forward
Predicted Peptide Sequence 
NNAVSLSLFYRDFFWRPTAAAAALEFLEPPGSRNXSTRGGGRQDTERRATDPDAATERRKYGGVEPNLPKEVWLFLLGYHSYDLIYADRE
HLEFVIKTDYXNDRKPMEDHLKEHAKRFIEFRERRGLIEKDVVRTDKLDSFYEEDDNPNINCLRDILLTYSFYNFDLGYCQGMSDLLSPI
FVYMGDESETFCDLLAVDAYPPTFLLPTIQRAPP
Predicted Coding Sequence 
AATAACGCCGTCTCGTTATCTCTCTTCTACAGGGACTTTTTTTGGCGCCCCACCGCGGCGGCGGCCGCACTAGAATTTTTGGAGCCCCCC
GGCAGCAGGAACXGCAGCACGAGGGGGGGCGGGAGACAGGACACCGAACGGAGAGCCACAGACCCAGACGCAGCAACAGAGAGAAGAAAA
TATGGTGGAGTGGAACCAAATCTACCTAAAGAGGTGTGGTTATTTCTGTTGGGATACCATTCATATGATTTAATTTATGCAGATAGGGAA
CACCTTGAGTTCGTCATAAAGACAGATTATXTAAACGATAGAAAACCAATGGAAGATCATCTCAAGGAGCATGCAAAAAGATTTATAGAA
TTCCGAGAGAGGAGAGGCCTCATTGAAAAAGATGTGGTGAGGACTGATAAGTTAGATTCATTCTATGAAGAGGATGACAACCCAAACATT
AATTGTTTGCGTGATATACTGCTGACATACTCATTCTACAACTTTGATTTGGGTTACTGTCAGGGTATGAGCGATCTTCTTTCACCAATA
TTTGTTTATATGGGAGATGAATCAGAGACATTCTGTGACTTATTGGCTGTTGATGCTTATCCTCCAACCTTCCTTCTTCCGACAATACAG
CGTGCTCCACCT
Edits in Original Sequence 
(5')AATAACGtCCGTCTCGTTATCTCTCTTCTACAGGGACTTTTTTTGGCGCCCCACCGCGGCGGCGGCCGCACTAGAATTTTTGGAGC
CCCCCGGCAGCAGGAACXGCAGCACGAGGGGGGGCGGGAGACAGGACACCGAACGGAGAGCCACAGACCCAGACGCAGCAACAGAGAGAA
GAAAATATGGTGGAGTGGAACCAAATCTACCTAAAGAGGTGTGGTTATTTCTGTTGGGATACCATTCATATGATTTAATTTATGCAGATA
GGGAACACCTTGAGTTCGTCATAAAGACAGATTATXTAAACGATAGAAAACCAATGGAAGATCATCTCtAAGGAGCATGCAAAAAGATTT
ATAGAATTCCGAGAGAGGAGAGGCCTCATTGAAAAAGATGTGGTGAGGACTGATAAGTTAGATTCATTCTATGAAGAGGATGACAACCCA
AACATTAATTGTTTGCGTGATATACTGCTGACATACTCATTCTACAACTTTGATTTGGGTTACTGTCAGGGTATGAGCGATCTTCTTTCA
CCAATATTTGTTTAtTATGGGAGATGAATCAGAGACATTCTGTGACTTATTGGCTGTTGATGCTTATCCTCCAACCTTCCTaTCTTCCGA
CAATACAGCGTGCTCCACCT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan