ESTScan Details for Unigene SGN-U337560

Score 
420
Direction 
Forward
Predicted Peptide Sequence 
MGKELDHSKSLDKEEAVIMQNIDEDEIFPPEKNRNSLCIRKIEGNKKTXDALNEDGSLDSAEESPVHGKSLCLARSFSSHFLINIDEMMS
DVGNEKGALISKTPKGKMGIFSFDRSSISSSEXIKLAATIMAVNTSYILEAXVAFFMYVNVISEKSPLVCCSENNILKSKDQEDDDSCSW
NRIQIEPTLRIRLKFQDVKYSVALKGVENSDTEKCILXGVSGSACPGEILAXMGPSGGGKTPYXKLLSGKVKMIVX
Predicted Coding Sequence 
ATGGGGAAAGAACTAGATCACTCCAAGAGCCTTGACAAGGAAGAGGCTGTCATCATGCAGAATATCGATGAGGATGAGATTTTTCCACCT
GAAAAAAACAGGAATAGTTTGTGCATTCGGAAAATAGAAGGCAATAAAAAGACTAXAGACGCGCTTAATGAAGATGGAAGCCTAGACTCT
GCTGAGGAATCACCAGTACATGGAAAATCTTTGTGTCTAGCAAGATCATTTAGTTCTCATTTTCTTATTAACATAGATGAGATGATGAGT
GATGTTGGTAATGAAAAAGGTGCACTTATAAGTAAGACTCCAAAAGGGAAAATGGGAATTTTCTCATTCGATCGATCCTCCATTTCCTCA
TCAGAAXACATAAAATTAGCAGCCACAATTATGGCAGTGAACACAAGTTATATACTAGAAGCTAXGGTTGCCTTTTTTATGTATGTGAAT
GTGATTTCTGAAAAAAGTCCCCTTGTTTGTTGTTCAGAGAACAATATATTGAAATCGAAGGATCAGGAGGATGACGATTCATGCAGCTGG
AATAGAATTCAGATTGAGCCTACCTTACGTATACGTCTCAAGTTTCAAGATGTGAAGTACTCCGTTGCACTGAAGGGAGTGGAGAATTCT
GATACAGAAAAGTGCATACTTNCAGGAGTGAGTGGTTCAGCCTGTCCAGGAGAAATTCTCGCGNTAATGGGACCTTCCGGTGGGGGTAAA
ACACCTTACXTCAAGCTTCTAAGTGGAAAGGTGAAAATGATAGTGGXX
Edits in Original Sequence 
GATTGCATAGATCTTCCTAAGTTTGAGGTCTAACCAACCGAGATAAATGGGGAAAGAACTAGATCACTCCAAGAGCCTTGACAAGGAAGA
GGCTGTCATCATGCAGAATATCGATGAGGAT
(5')ATGGGGAAAGAACTAGATCACTCCAAGAGCCTTGACAAGGAAGAGGCTGTCATCA
TGCAGAATATCGATGAGGATGAGATTTTTCCACCTGAAAAAAACAGGAATAGTTTGTGCATTCGGAAAATAGAAGGCAATAAAAAGACTA
XAGACGCGCTTAATGAAGATGcGAAGCCTAGACTCTGCTGAGGAATCACCAGTACATGGAAAATCTTTGTGTCTAGCAAGATCATTTAGT
TCTCATTTTCTTATTAACATAGATGAGATGATGAGTGATGTTGGTAATGAAAAAGGTGCACTTATAAGTAAGACTCCAAAAGGGAAAATG
GGAATTTTCTCATTCGATCGATCCTCCATTTCCTCATCAGAAXACATAAAATTAGCAGCCACAATTATGGCAGTGAACACAtAGTTATAT
ACTAGAAGCTAXGGTTGCCTTTTTTATGTATGTGAATGTGATTTCTGAAAAAAGTCCCCTTGTTTGTTGTTCAGAGAACAATATATTGAA
ATCGAAGGATCAGGAGGATGACGATTCATGCAGCTGGAATAGAATTCAGATTGAGCCTACCTTACGTATACGTCTCAAGTTTCAAGATGT
GAAGTACTCCGTTGCACTGAAGGGAGTGGAGAATTCTGATACAGAAAAGTGCATACTTNCAGGAGTGAGTGGTTCAGCCTGTCCAGGAGA
AATTCTCGCGNTAATGGGACCTTCCGGTGGGGGTAAAACACCTTACXTCAAGCTTCTAAGTGGAAAGGTGAAAATGATAGTGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan