ESTScan Details for Unigene SGN-U337561

Score 
-306
Direction 
Reverse
Predicted Peptide Sequence 
PRRGRLFPGGKKRPGEFFNKAPVGVLPPPLDFKALGFFVDAFSRGGGSPIGKKRQATGPFFGVPGPFWWPFCSQVFFVGYPPDSVDNGIT
PWSELIPLAAAERPSAAESLSEEAEERPIRKPPLPAVGRFINAGGTTGFPTGKRAVSATQLMELAHSLGTPGFTLYASGRMLCGIVTDNN
FTQETAMTMITPSSKLTLTKGNKSRTSTAVA
Predicted Coding Sequence 
XXCCCCCGCAGGGGGAGGCTTTTCCCAGGGGGGAAAAAACGCCCTGGGGAATTCTTTAATAAAGCCCCTGTTGGGGTTTTGCCCCCCCCT
TTGGACTTTAAGGCGTTGGGATTTTTTGTTGATGCTTTCTCCAGGGGGGGGGGGAGCCCTATTGGGAAAAAACGCCAGGCAACGGGGCCT
TTTTTTGGGGTTCCTGGGCCCTTTTGGTGGCCCTTTTGCTCCCAAGTTTTTTTCGTGGGTTATCCCCCTGATTCTGTGGATAACGGTATT
ACCCCTTGGAGTGAGTTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCATTGAGCGAGGAAGCGGAAGAGCGCCCAATA
CGCAAACCCCCTCTCCCCGCCGTTGGCCGATTCATTAATGCAGGTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACG
CAATTAATGGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCCGTATGTTGTGTGGAATTGTGACGGATAAC
AATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCCGCACCTCCACCGCG
GTGGCG
Edits in Original Sequence 
(5')XXCCCCCGCAGGGGGAGGCTTTTCCCAGGGGGGAAAAAACGCCCTGGGGAATTCTTTAATAAAGCCCCTGTTcGGGGTTTTGCCCC
CCCCTTTGGACTTTAAGGCGTTGGGATTTTTTGTTGATGCTTTCTCCAGGGGGGGGGGGAGCCCTATTGGGAAAAAACGCCAGGCaAACG
GGGCCTTTTTTTGGGGTTCCTGGGCCCTTTTGGTGGCCCTTTTGCTCCCAAGTTTTTTTCGTGGGTTATCCCCCTGATTCTGTGGATAAC
GGTATTACCgCCTTGGAGTGAGTTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCATTGAGCGAGGAAGCGGAAGAGCG
CCCAATACGCAAACCCCCTCTCCCCGCgCGTTGGCCGATTCATTAATGCAGGTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGA
GCGCAACGCAATTAATGtGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCtCGTATGTTGTGTGGAATTGT
GAgCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCCGCA
CCTCCACCGCGGTGGCG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan