ESTScan Details for Unigene SGN-U337579

Score 
363
Direction 
Forward
Predicted Peptide Sequence 
VLAVWVFXAVLFEALLQPQSNIEAIAEEAAATECEFTVTPSGLAYCDKAVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRV
GVGEVIKGWDQGILGGDGFPPMLTGGKRKLKIPPELGYGKEELAAEEVRXIIPPDSVLLFDVEFVGKA
Predicted Coding Sequence 
GTGCTTGCGGTTTGGGTTTTTXCGGCGGTTTTGTTCGAGGCTCTTTTGCAGCCACAGTCGAATATTGAAGCAATTGCTGAAGAAGCTGCA
GCTACGGAATGTGAGTTCACAGTTACACCTTCAGGTCTTGCTTATTGTGATAAAGCTGTAGGTTATGGACCTGAAGCTGTTAAAGGACAA
TTGATCAAGGCACATTATGTAGGTAAACTGGAAAATGGGAAGGTCTTTGATAGCAGCTATAATCGTGGAAAGCCTCTTACATTTCGCGTT
GGTGTTGGCGAGGTTATTAAAGGTTGGGATCAGGGAATTCTAGGAGGTGATGGTTTTCCTCCAATGCTAACTGGAGGAAAGCGTAAACTG
AAGATTCCTCCAGAACTTGGATATGGGAAAGAGGAGCTGGCTGCAGAGGAGGTACGTGXCATTATTCCTCCAGACTCAGTTCTACTGTTC
GATGTGGAGTTCGTTGGCAAGGCGTAG
Edits in Original Sequence 
GGTTCAGTAGAAGAGAAACCCTAAGTGCTTGCGGTTTGGGTTTTTCGGCGGTTTTGTTCGAGGCTCTTTTGCAGCCACAGTCGAATATTG
AAG
(5')GTGCTTGCGGTTTGGGTTTTTXCGGCGGTTTTGTTCGAGGCTCTTTTGCAGCCACAGTCGAATATTGAAGCAATTGCTGAAGA
AGCTGCAGCTACGGAATGTGAGTTCACAGTTACACCTTCAGGTCTTGCTTATTGTGATAAAGCTGTAGGTTATGGACCTGAAGCTGTTAA
AGGACAATTGATCAAGGCACATTATGTAGGTAAACTGGAAAATGGGAAGGTCTTTGATAGCAGCTATAATCGTGGAAAGCCTCTTACATT
TCGCGTTGGTGTTGGCGAGGTTATTAAAGGTTGGGATCAGGGAATTCTAGGAGGTGATGGTTTTCCTCCAATGCTAACTGGAGGAAAGCG
TAAACTGAAGATTCCTCCAGAACTTGGATATGGGAtAAGAGGAGCTGGCTGCAGAGGAGGTACGTGXCATTATTCCTCCAGACTCAGTTC
TACTGTTCGATGTGGAGTTCGTTGGCAAGGCGTAG(3')GCTTAATACTTTTAGAGACTTTTGCAGTACATACCGTGACCTGCTTGTATA
TTTTTGGTTATCTTTACAAAAATTACAATTATTTCGTACAGAATGTTACAAACTATATAAAGTAATTTTGCGAGGAACC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan