ESTScan Details for Unigene SGN-U337615

Score 
-374
Direction 
Reverse
Predicted Peptide Sequence 
GGPLYARHGLLCLRAGXEPVSLSKGPWGPVPFGFFSPPFFAQXFAGFSPVKALKWGAPFRVSNLGLLGPLAPKKLDLGECFPSGAFAPID
GFSPFDVGATFFYSGLLFQTGTTLNPISVYFFDXIRDFADLAYWLKNELINKNLTRILQNINAYNLPFAIQAAQLLGRAIGAGLFAITPA
GERGMCCKAIKLGNARVFPVTTL
Predicted Coding Sequence 
GGGGGGCCACTTTATGCCCGGCACGGTTTGTTGTGTTTACGCGCAGGTGXTGAGCCGGTTTCCCTTTCCAAAGGCCCTTGGGGCCCCGTC
CCCTTTGGATTTTTTTCCCCTCCCTTTTTTGCCCAAGXTTTTGCCGGATTTTCCCCCGTCAAGGCTTTAAAATGGGGGGCTCCCTTTAGG
GTTTCCAATTTAGGGCTTTTGGGCCCCTTGGCCCCCAAAAAACTTGATTTAGGGGAATGTTTCCCTAGTGGGGCATTCGCCCCGATAGAC
GGTTTTTCGCCCTTTGACGTTGGAGCCACGTTTTTTTATAGTGGACTCTTGTTCCAAACTGGAACAACACTCAACCCTATTTCGGTGTAT
TTTTTTGATTTXATAAGGGATTTTGCCGATTTGGCCTATTGGTTAAAAAATGAGCTGATTAACAAAAATTTAACGCGAATTTTACAAAAT
ATTAACGCTTACAATTTGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTTTTCGCTATTACGCCAGCT
GGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGTTGTAA
Edits in Original Sequence 
(5')GGGGGGCCACTTTATGCCCGGCACGGTTTGTTGTGTTTACGCGCAGGTGXTGAGCCGGTTTCCCTTTCCAAAGGCCCTTGGGGCCC
CGTCCCCTTTGGATTTTTTTCCCCTCCCTTTTTTGCCCAAGXTTTTGCCGGATTTTCCCCCGTCAAGGCTTTAAAATcGGGGGGCTCCCT
TTAGGGTTTCCAATTTAGGGCTTTTgGGGCCCCTTGGCCCCCAAAAAACTTGATTTAGGGGAATGTTTCCCgTAGTGGGGCATTCGCCCC
GATAGACGGTTTTTCGCCCTTTGACGTTGGAGtCCACGTTTTTTTATAGTGGACTCTTGTTCCAAACTGGAACAACACTCAACCCTATTT
CGGTGTATTTTTTTGATTTXATAAGGGATTTTGCCGATTTcGGCCTATTGGTTAAAAAATGAGCTGAtTTAACAAAAATTTAACGCGAAT
TTTaACAAAATATTAACGCTTACAATTTGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTTTTCGCTA
TTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGTTGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan