ESTScan Details for Unigene SGN-U337616

Score 
-225
Direction 
Forward
Predicted Peptide Sequence 
MVIAVSWVKLLSLTIPHNIRAGSINVKPGVPNDELTHINCVALTARFPVGKPVVPAAINESANAAGRGGLRIGRSSASSLTXLAALGRSA
AAAVSAHSKAVYGYPQKSGDNXRKEHVSKRPAKGQEP
Predicted Coding Sequence 
ATGGTCATAGCTGTTTCCTGGGTGAAATTGTTATCCCTCACAATTCCACACAACATACGAGCCGGAAGCATAAATGTAAAGCCTGGGGTG
CCTAATGATGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCXATTAATGAA
TCGGCCAACGCXGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGAXCTCGCTGCGCTCGGTCGTTCGGCT
GCGGCGGCGGTATCAGCTCACTCAAAGGCGGTATACGGTTATCCACAGAAATCAGGGGATAACXGCAGGAAAGAACATGTGAGCAAAAGG
CCAGCAAAAGGCCAGGAACCGTAA
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTTTTTTTCCACAAAAAATTTGGCCTTTATACTTATTTGATTGATCAATTGACTGAATATTTCTTTCCATTAT
AGTCACTCACAAATACAAAATCCCATCAATCCATCAACAAAATAGAGTGAAGCACAAATGAAAGAAAATGAGAGAACATGTTACAAAAAT
TCTGATAAAAGGAAAAATTTGTGAGGTTTTTGAAGATACATTCACACATGATATACATACAAGACAACGATTTTAGCGATGATGATGCTC
CAATTCGCGTCTATGCTTGTGACTAAAAGTCCATAGGGGTTACTGAAAATCGAAAGGAGATTTCAC
(5')ATGGTCATAGCTGTTTCCTG
GGTGAAATTGTTATCCgCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAgTGTAAAGCCTGGGGTGCCTAATGAgTGAGCTAAC
TCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCXATTAATGAATCGGCCAACGCXGCGGG
GAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGAXCTCGCTGCGCTCGGTCGTTCGGCTGCGGCGaGCGGTATCAG
CTCACTCAAAGGCGGTaATACGGTTATCCACAGAAATCAGGGGATAACXGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAG
GAACCGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan