ESTScan Details for Unigene SGN-U337637

Score 
-241
Direction 
Reverse
Predicted Peptide Sequence 
TEPTLNPIWSILLIIKGFADFGPIGXKNELINKKFNANFNXNINAYNLPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVF
PVTTVVKRRPVNCNTTHYRANWVPGP
Predicted Coding Sequence 
XTAACTGAACCAACACTCAACCCTATCTGGTCTATTCTTTTGATTATTAAGGGATTTGCCGATTTCGGGCCTATTGGTAAXAAAAATGAG
CTGATTAACAAAAAATTTAACGCGAATTTTAACAAXAATATTAACGCTTACAATTTGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGA
AGGGCGATCGGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTT
TTCCCAGTCACGACXGTTGTAAAACGACGGCCAGTGAATTGTAATACGACTCACTATAGGGCGAATTGGGTACCGGGCCCC
Edits in Original Sequence 
(5')XTAACTGAACCAACACTCAACCCTATCTcGGTCTATTCTTTTGATTATTAAGGGATTTGCCGATTTCGGGCCTATTGGTAAXAAAA
ATGAGCTGATTAACAAAAAATTTAACGCGAATTTTAACAAXAATATTAACGCTTACAATTTGCCATTCGCCATTCAGGCTGCGCAACTGT
TGGGAAGGGCGATCGGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCA
GGGTTTTCCCAGTCACGACXGTTGTAAAACGACGGCCAGTGAATTGTAATACGACTCACTATAGGGCGAATTGGGTACCGGGCCCC(3')
TCGAGCTAGAATGAAAATAGACTCTAACAGTAGCATTCATTAGTTCTTCATGCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan