ESTScan Details for Unigene SGN-U337659

Score 
-334
Direction 
Forward
Predicted Peptide Sequence 
MASPDTDVPMVPAGESSTGAGTSNKKPKRFEIKKWNAVSLWAWDIVVEIVPSVGITSWICVSSVKLIKLAQQVRNAQLLGVAQDSSSVPL
DNSEWEFQKYGXLEFTVGVTVNXEELQNYGHYSFSVIDVEKNNSAALCSFRFCSANIQSNDSNYVFNCRMSVLGCLKRMKCVWRLTISYS
KKKKKKKNFRGGAGNQFPLKGGHIKXXXXXXXXXXAPGPPPRRLRLGPCAAPPAYDGTAAEGPLPTQAEASDXAAPGLQHDPQNATATRL
RGTSAIPTPPTVAAAXTPRPSLTTGALAIVQAALATCPPARAHIPALLCWSPPPPPHLTSVSQPAXQGHSAALAPAAAHHALCHRLA
Predicted Coding Sequence 
ATGGCGTCACCGGATACCGATGTGCCGATGGTTCCCGCCGGCGAGAGTTCAACCGGAGCTGGAACGTCTAACAAAAAGCCGAAGCGATTT
GAGATCAAAAAGTGGAACGCCGTTTCTCTCTGGGCTTGGGATATTGTGGTAGAAATTGTGCCATCTGTAGGAATCACATCATGGATCTGT
GTATCGAGTGTCAAGCTAATCAAGCTAGCGCAACAAGTGAGGAATGCACAGTTGCTTGGGGTGGCTCAAGACTCGTCAAGTGTGCCACTT
GATAACAGCGAGTGGGAGTTTCAGAAGTATGGTXCACTAGAATTTACTGTTGGTGTXACAGTGAATGAXGAGGAGCTTCAAAACTATGGT
CATTACAGTTTTTCTGTCATCGACGTTGAAAAGAACAATTCTGCTGCCTTATGTTCCTTTCGTTTTTGCTCTGCAAATATCCAAAGCAAT
GACTCGAACTATGTTTTTAATTGTCGCATGTCTGTTTTAGGTTGCCTCAAAAGAATGAAATGTGTTTGGAGACTAACCATTTCTTATTCG
AAAAAAAAAAAAAAAAAAAAAAACTTTCGGGGGGGGGCCGGGAACCAATTTCCCCTTAAAGGGGGCCATATAAAANNNNNNNNNNTNNNN
NNTGNNNTNCNNNNNGCGCCGGGCCCCCCCCCCCGCCGGCTCCGTCTGGGCCCCTGCGCCGCTCCTCCCGCGTACGACGGCACCGCCGCC
GAAGGCCCGCTACCCACCCAGGCTGAGGCTAGTGATXCCGCCGCCCCTGGGCTTCAACACGACCCCCAGAACGCCACCGCCACCCGCCTC
CGCGGGACGTCAGCTATCCCCACCCCCCCAACAGTCGCCGCAGCAXCAACACCGCGCCCCAGCCTTACCACCGGTGCCCTCGCCATAGTC
CAAGCCGCCCTCGCXACGTGCCCACCTGCCCGCGCCCACATCCCCGCACTCCTATGTTGGTCCCCACCACCTCCACCCCACCTCACGTCT
GTTTCGCAGCCCGCTXCACAAGGTCACTCCGCCGCACTAGCACCAGCCGCTGCTCACCACGCTCTCTGTCATCGTCTAGCG
Edits in Original Sequence 
CGATATAGTTTTGAAAAATCTGTGAACTCTTCGAAGCTTAACCTTCAATGGCGTCACCGGATACCGATGTGCCGATGGTTCCCGCCGGCG
AGAGTTCAACCGGAGCTG
(5')ATGGCGTCACCGGATACCGATGTGCCGATGGTTCCCGCCGGCGAGAGTTCAACCGGAGCTGGAACGTC
TAACAAAAAGCCGAAGCGATTTGAGATCAAAAAGTGGAACGCCGTTTCTCTCTGGGCTTGGGATATTGTGGTAGAtAATTGTGCCATCTG
TAGGAATCACATCATGGATCTGTGTATCGAGTGTCAAGCTAATCAAGCTAGCGCAACAAGTGAGGAATGCACAGTTGCTTGGGGTGGCTC
AAGACTCGTCAAGTGTGtCCACTTGATAACAGCGAGTGGGAGTTTCAGAAGTATGGTXCACTAGAATTTACTGTTGGTGTXACAGTGAAT
GAXGAGGAGCTTCAAAACTATGGTCATTACAGTTTTTCTGTCATCGACGTTGAAAAGAACAATTCTGCTGCCTTATGTTCCTTTCGTTTT
TGCTCTGCAAATATCCAAAGCAATGACTCGAACTATGTTTTTAATTGTCGCATGTCTGTTTTAGGTTGCCTCAAAAGAATGAAATGTGTT
TGGAGACTAACCATTTCTTATTCGAAAAAAAAAAAAAAAAAAAAAAACTTTCGGGGGGGGGCCGGGAACCAATTTCCCCTTAAAGGGGGC
CATATAAAANNNNNNNNNNTNNNNNNTGNNNTNCNNNNNGCGCCGGGCCCCCCCCCCCGCCGGCTCCGTCTGGGCCCCTGCGCCGCgTCC
TCCCGCGTACGACGGCACCGCCGCCGAAGGCCCGCTACCCACCCAGGCTGAGGCgTAGTGATXCCGCCGCCCCTGGGCTTCAACACGACC
CCCAGAACGCCACCGCCACCCGCCTCCGCGGGtACGTCAGCTATCCCCACCCCCCCAACAGTCGCCGCAGCAXCAACACCGCGCCCCAGC
CTTACCACCGGTGCCCTCGCCATAGTCCAAGCCGCCCTCGCXACGTGCCCACCTGCCCGCGCCCACATCCCCGCACTCCTATGTTGGTCC
CCACCACCTCCACCCCACCTCACGTCTGTTTCGCAGCCCGCTXCACAAGGTCACTCCGCCGCACTAGCACCAGCCGCTGCTCACCACGCT
CTCTGTCATCGTCTAGCG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan