Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U337740

Score 
416
Direction 
Reverse
Predicted Peptide Sequence 
VMSSSTQFSPVIQQYFAEKSNPSSISAFKASKLVLLVPISXNCSRIHLDFKVRVQVLENHDGESSVQDLDDSPASIELQHISDEPQFDRV
IAEAQQLDESIGFYGWQTGAANAYXLKPKLEKLAADYFPRTRFYSVDVNNVPHKLVVRAGVTKMPPYSYGGMGRNKRK
Predicted Coding Sequence 
XTGGTAATGTCTAGCTCAACACAATTTTCTCCAGTTATTCAACAGTATTTCGCAGAAAAATCGAACCCATCGTCCATTTCAGCTTTTAAA
GCTTCAAAATTGGTACTTTTAGTACCAATTTCCNTAAATTGTTCAAGAATTCACTTGGATTTTAAGGTGAGAGTTCAGGTTTTGGAAAAT
CATGATGGAGAAAGTTCTGTACAAGATCTTGATGATTCACCTGCTTCGATTGAGCTACAACACATTTCTGATGAACCCCAATTTGATCGA
GTTATAGCTGAAGCACAACAGCTTGATGAATCTATTGGATTCTATGGATGGCAAACTGGTGCCGCAAATGCATATXACTTGAAACCAAAA
TTGGAAAAACTGGCTGCTGACTACTTCCCAAGAACACGCTTTTACTCTGTTGATGTCAATAATGTTCCACACAAGCTTGTGGTTCGCGCT
GGAGTAACTAAAATGCCACCATACAGTTATGGAGGGATGGGAAGAAACAAGCGGAAGTAA
Edits in Original Sequence 
(5')XTGGTAATGTCTAGCTCAACACAATTTTCTCCAGTTATTCAACAGTATTTCGCAGAAAAATCGAACCCATCGTCCATTTCAGCTTT
TAAAGCTTCAAAATTGGTACTTTTAGTACCAATTTCCNTAAATTGTTCAAGAATTCACTTGGATTTTAAGGTGAGAGTTCAGGTTTTGGA
AAATCATGATGGAGAAAGTTCTGTACAAGATCTTGATGATTCACCTGCTTCGATTGAGCTACAACACATTTCTGATGAACCCCAATTTGA
TCGAGTTATAGCTGAAGCACAACAGCTTGATGAATCTATTGtGATTCTATGGATGGCAAACTGGTGCCGCAAATGCATATXACTTGAAAC
CAAAATTGGAAAAACTGGCTGCTGACTACTTCCCAAGAACACGCTTTTACTCTGTTGATGTCAATAATGTTCCACACAAGCTTGTGGTTC
GCGCTGGAGTAACTAAAATGCCgACCATACAGTTATGGAGGGATGGGAAGAAACAAGCGGAAGTAA(3')TCCTATACTTCCATTAGAAT
CCATTTTCCCAGTTTTGTTCTGGTTCATATCCTATATACATTTACTTCAGATGTACTTTTGAAAAGGTAAAATATACACACAGATTGATT
TTGTTTTATTTTTTTGAAACACTCAAAGAGGAAAATGTTTATTTCTTTTTCTGTATCCTGTACATTTATCGAAAACAGCAGGTCCTCAAA
TGTCCATTTATGATATGTACTAATTATTGTTTCTTTTCTCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan