ESTScan Details for Unigene SGN-U337745

Score 
307
Direction 
Forward
Predicted Peptide Sequence 
MFMAXTAAGLYILLRAADRFAANYNKFPGQFDGEMDEDISRLKTTAVGLLNDLGCNGSSVSEALLNEIVRYGASEAHVVAAFGGGVTITR
SDQAHXLDISFPCLELXILNGIDHKISTVVALISESPVAFSQFFNLR
Predicted Coding Sequence 
ATGTTTATGGCAGXTACTGCTGCGGGTCTTTATATTCTTCTTCGAGCAGCTGACCGGTTTGCTGCGAACTATAACAAATTTCCTGGACAA
TTTGATGGTGAGATGGATGAGGATATATCCCGGCTGAAAACTACAGCTGTTGGCCTACTCAATGACCTTGGTTGCAATGGTTCTTCTGTA
TCAGAGGCCTTATTAAATGAGATTGTGCGGTATGGTGCTTCGGAGGCTCATGTTGTAGCTGCCTTTGGTGGAGGAGTCACAATCACAAGG
AGTGATCAAGCTCATCAXCTAGACATTTCATTCCCATGTCTTGAACTTXTAATTCTTAATGGCATAGATCACAAAATCTCAACTGTGGTT
GCTCTAATCTCTGAATCACCAGTAGCATTTTCTCAATTTTTCAATCTTAGATAA
Edits in Original Sequence 
TAATGCTGAGTGGAAATAACGATAAACACTCACCCTTTGAAGCAATTTAGCTGTTGGGATGGTGTAAACTGGATTTTTGTGTTAACAGTT
GCTTTCTGATGTGTCTCTCGATTCTCTTTCCATTAGTAGATCATCTGGCCTGTAAATGTAGGGGGGAAATAAAGAAATGCGAAGTTAAAG
ACTTGTTGCTGAGATTAATAGTTTAATACAATACTCTTTGACAATTAAACAAAATGAAGCTTAAGGAGAGTTTGACTTGGTCATTTAGTT
TGACATTAAAGACATCAGATATTCTGAATGGGTGCTCAATTTTTTTCTTTTCTTTCTGAACTATAAATGTTTATGGCAGTACTGCTGCGG
GTCTTTATATTCTTCTTCGAGCAGCTGACCGGTTTGCTGCGAACTATAACAAATTTCCTGGACAATTTG
(5')ATGTTTATGGCAGXTAC
TGCTGCGGGTCTTTATATTCTTCTTCGAGCAGCTGACCGGTTTGCTGCGAACTATAACAAATTTCCTGGACAATTTGATGGTGAGATGGA
TGAGGATATATCCCGGCTGAAAACTACAGCTGTTGGCCTACTCAATGACCTTGGTTGCAATGGTTCTTCTGTATCAGAGGaCCTTATTAA
ATGAGATTGTGCGGTATGGTGCTTCGGAGGCTCATGTTGTAGCtTGCCTTTGGTGGAGGAGTCACAATCACAAGGAGTGATCAAGCTCAT
CAXCTAGACATTTCATTCCCATGTCTTGAACTTXTAATTCTTAATGGCATAGATCACAAAATCTCAACTGTGGTTGCTCTAATCTCTGAA
TCACCAGTAGCATTTTCTCAATTTTTCAATCTTAGATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan