ESTScan Details for Unigene SGN-U337810

Score 
-24
Direction 
Forward
Predicted Peptide Sequence 
GLDKHWSSTAVAAALELVDPRAAGIRHQVTRAD
Predicted Coding Sequence 
XXTGGACTTGACAAACACTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCGGGCTGCAGGAATTCGGCACCAGGTC
ACGCGTGCGGAT
Edits in Original Sequence 
(5')XXTGGACTTGACAAACACTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATcCCCCGGGCTGCAGGAATTCGGCACC
AGGTCACGCGTGCGGAT(3')TAAATAAATAATTAAAACAAATTTTGTCCAAAAAATAATCTCTCGATCGATCATTTGCCGAAGCCGAAG
CGAGCGACGACGACGGCGCGAGGAGGGTCCCTCTTTCCAACCCTTTTAACAATTAATAGGAGTTTTTATGTATTTAAACACTCCTATTTT
TTTTTTTCATTACCGATGAGGGACAATTGCTTTTTCATTAAAGCATAAGAGGACTTTTCAATTTCCCAACTCTTCAAGTTCTCAACTTTT
CAAATTCCTCTCCTTCCCTCTATTTTCCGTTAATTCTTGCTACATACCCAGCAGTATGAGGTGGGCATAGCTACATATTAGTAATGTCTC
TCTTAGTTGGTTCCGTTAGCCTTGATATAACACTTATTTTTTGGTCAAATTCGAATGAAATTGTTGTCACATATTGAGCAGAAGTACTGC
AACTCTTCTTTTTTTTATGGGGCGGGGGGGATTTGAGTGAAGTTGTTGTTACCTTTTGAGAAAAATTGTTGCATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan