ESTScan Details for Unigene SGN-U337817

Score 
-186
Direction 
Reverse
Predicted Peptide Sequence 
VTIRIPQSGWANFXKXAMGPALFVITPVGKRGCFPGDLSWLTAGFFPVTTLKXPPSEIVIRLTIGANGVPGPPASFFFFFDSQDFLFQYI
MVQWCTSSSTTSVTRPNQRPNRGISDNRDIDMVMAXYATRDYINDLQWYRAGSAXPGLANVLSGVHKLADGHVIECCTRGVDQFLRVLEL
KISCNYSCAPSTLNNRPIYDHLCLEWDTNTKANK
Predicted Coding Sequence 
XGGGTTACAATTCGCATTCCGCAATCCGGTTGGGCCAATTTTNGGAAAGXGGCGATGGGTCCGGCCCTCTTCGTTATTACGCCAGTTGGG
AAAAGGGGATGTTTTCCAGGCGATTTAAGTTGGTTAACGGCAGGTTTTTTCCCAGTCACGACGTTGAAANCGCCGCCCAGTGAAATTGTA
ATCCGCCTCACTATAGGGGCGAATGGGGTACCGGGCCCCCCTGCGAGTTTTTTTTTTTTTTTTGATTCGCAGGATTTTCTCTTTCAATAT
ATCATGGTTCAATGGTGTACTTCATCAAGCACCACTTCAGTTACAAGGCCGAACCAGAGGCCAAATAGGGGAATTTCAGATAATAGAGAT
ATTGATATGGTGATGGCAGAXTACGCCACTCGAGATTATATCAATGATCTGCAATGGTACAGAGCTGGATCTGCTGXACCAGGTTTAGCA
AATGTGTTGAGTGGAGTTCATAAACTTGCXGATGGGCATGTGATAGAATGTTGCACTCGAGGAGTAGACCAATTTCTTCGAGTCCTTGAG
CTGAAAATCAGTTGCAACTACAGTTGTGCTCCTTCCACTCTTAATAATAGACCCATCTACGATCACCTCTGCCTAGAGTGGGACACAAAT
ACAAAAGCAAATAAATAG
Edits in Original Sequence 
(5')XGGGTTACAATTCGCATTCCGCAATCCGGTTGGGCCAATTTTNGGAAAGXGGCGATGGGTCCGGCCCTCTTCGTTATTACGCCAGT
TGGGAAAAGGGGATGTTTTCCAGGCGATTTAAGTTGGTTAACGGCAGGTTTTTTCCCAGTCACGACGTTGtAAANCGCCGCCCAGTGAAA
TTGTAATCCGCCTCACTATAGGGGCGAATGGGGTACCGGGCCCCCCTGCGAGTTTTTTTTTTTTTTTTGATTCGCAGGATTTTCTCTTTC
AATATATCATGGTTCAATGGTGTACTTCATCAAGCACCACTTCAGTTACAAGGCCGAACCAGAGGCCAAATAGGGGAATTTCAGATAATA
cGAGATATTGATATGGTGATGGCAGAXTACGCCACTCGAGATTATATCAATGATCTGCAATGGTACAtGAGCTGGATCTGCTGXACCAGG
TTTAGCAAATGTGTTGAGTGGAGTTCATAAACTTGCXGATGGGCATGTGATAGAATGTTGCACTCGAGGAGTAGACCAATTTCTTCGAGT
CCTTGAGCTGAAAATCAGTTGCAACTACAGTTGTGCTCCTTCCACTCTTAATAATAGACCCATCTACGATCACCTCTGCCTAGAGTGGGA
CACAAATACAAAAGCAAATAAATAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan