ESTScan Details for Unigene SGN-U337822

Score 
417
Direction 
Forward
Predicted Peptide Sequence 
LAGAPRGGGRSTTSGSPGLQEFGTRAGDLEEAPEMYVVPPPKRPDPLSGSEDLRIYQTWKGSNIFFFQGRFIFGPDARSLALTIFLIVAP
VSVFCVFVARKLMDDFSNHLGILIMVVVIVFTFYVLVLLLLTSGRDPGIIPRNAHPPEPEGYDGTVEGGGQTPQLRLPRIKEVEVNGITS
RSNTVTPACFIDLPAVLTVQSANNALKDLTITALGRAMHWAAKLPXFLYGCLLYTLLCIYVFGXCWVYIKRIMVLDDTTIWKAMIKTPPP
LANSX
Predicted Coding Sequence 
XXTTTAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTACAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGCTGGAGATCTC
GAGGAAGCCCCAGAGATGTATGTCGTTCCTCCTCCAAAACGACCCGATCCATTGTCTGGATCCGAGGACTTGCGGATTTACCAGACATGG
AAAGGAAGCAATATATTTTTCTTCCAAGGAAGGTTCATATTTGGGCCAGACGCAAGATCCCTAGCACTGACCATATTTCTCATAGTGGCC
CCTGTCTCAGTTTTCTGTGTCTTTGTTGCAAGAAAGCTCATGGATGATTTTTCAAATCACCTGGGGATATTGATTATGGTTGTAGTCATT
GTGTTCACATTCTATGTTTTAGTTCTACTCCTTCTCACATCTGGAAGGGATCCAGGAATAATTCCTCGTAATGCACACCCTCCAGAACCA
GAAGGTTATGATGGTACTGTGGAAGGTGGTGGACAAACCCCTCAATTACGTTTGCCTCGCATTAAAGAAGTTGAGGTCAATGGCATTACC
TCAAGATCAAATACTGTGACACCTGCATGCTTTATAGACCTCCCCGCTGTTCTCACTGTTCAATCTGCAAATAATGCGTTGAAAGATTTG
ACCATCACTGCCCTTGGTAGGGCAATGCATTGGGCTGCGAAACTACCGNTTTTTCTTTATGGTTGTCTTCTCTACACACTTCTTTGCATA
TATGTTTTTGGGNTCTGCTGGGTCTATATTAAGAGAATCATGGTTCTAGATGACACCACCATATGGAAAGCAATGATCAAAACACCGCCT
CCATTGGCTAATAGCTXX
Edits in Original Sequence 
(5')XXTTTAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTACAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGCTGGAGA
TCTCGAGGAAGCCCCAGAGATGTATGTCGTTCCTCCTCCAAAACGACCCGATCCATTGTCTGGATCCGAGGACTTGCGGATTTACCAGAC
ATGGAAAGGAAGCAATATATTTTTCTTCCAAGGAAGGTTCATATTTGGGCCAGACGCAAGATCCCTAGCACTGACCATATTTCTCATAGT
GGCCCCTGTCTCAGTTTTCTGTGTCTTTGTTGCAAGAAAGCTCATGGATGATTTTTCAAATCACCTGGGGATATTGATTATGGTTGTAGT
CATTGTGTTCACATTCTATGTTTTAGTTCTACTCCTTCTCACATCTGGAAGGGATCCAGGAATAATTCCTCGTAATGCACACCCTCCAGA
ACCAGAAGGTTATGATGGTACTGTGGAAGGTGGTGGACAAACCCCTCAATTACGTTTGCCTCGCATTAAAGAAGTTGAGGTCAATGGCAT
TACCgTCAAGATCAAATACTGTGACACCTGCATGCTTTATAGACCTCCCCGCTGTTCTCACTGTTCAATCTGCAAATAAcTGCGTTGAAA
GATTTGACCATCACTGCCCTTgGGTAGGGCAATGCATTGGGCTGCGAAACTACCGNTTTTTCTTTATGGTTGTCTTCTCTACACACTTCT
TTGCATATATGTTTTTGGGNTCTGCTGGGTCTATATTAAGAGAATCATGGTTCTAGATGACACCACCATATGGAAAGCAATGATCAAAAC
ACCGCCTCCATTGGtCTAATAGCTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan