ESTScan Details for Unigene SGN-U337886

Score 
103
Direction 
Forward
Predicted Peptide Sequence 
GVIASLDVPVYWVQTLKQDDGAQRXESLKSAQAVWVNPNWRFKLTLNKLYAWSLPDYDSVVMLDADNLFLQKTDELFQCGQFCADFINPC
IFHTGLFVLQPSKMAFNDMIHDIQIGRENQDGADQGFIGGHFPDLLXSADVPPLLLMVPKLQGKNQASFRKSKGRPFINYFKTPLGRDPG
GP
Predicted Coding Sequence 
GGCGTTATTGCTTCACTTGACGTTCCTGTTTACTGGGTTCAAACTCTAAAACAGGACGATGGTGCACAGCGTGXTGAGAGTTTAAAATCT
GCACAAGCCGTTTGGGTCAACCCTAATTGGAGATTCAAGCTCACACTGAACAAACTTTATGCGTGGAGCCTCCCGGATTATGACTCGGTT
GTCATGCTCGATGCAGATAACCTTTTCCTCCAGAAAACTGATGAACTGTTCCAATGTGGCCAGTTTTGTGCTGACTTCATCAATCCCTGC
ATCTTCCACACTGGTCTCTTCGTCTTACAGCCATCAAAAATGGCGTTCAATGACATGATTCATGACATACAGATTGGGAGGGAAAATCAA
GACGGTGCAGACCAAGGTTTTATTGGAGGTCACTTCCCTGATTTACTTGXATCGGCCGATGTTCCACCCCTACTCTTAATGGTACCCAAG
CTTCAGGGAAAAAACCAGGCTTCCTTTAGGAAATCAAAAGGGCGCCCTTTTATTAATTATTTTAAAACTCCCCTTGGTCGGGACCCTGGT
GGGCCCTAA
Edits in Original Sequence 
TGAGAGTTTAAAATCTGCACAAGCCGTATTGGGTCAACCCTAATTGGAGATTCAAGCTCACACTGAACAAACTTTATGCGTGGAGCCTCC
CGGATTATGACTCGGTTGTCATGCTCGATGCAGATAACCTTTTCCTCCAGAAAACTGATGAACTGTTCCAATGTGGCCAGTTTTGTGCTG
ACTTCATCAATC
(5')GGCGTTATTGCTTCACTTGACGTTCCTGTTTACTGGGTTCAAACTCTAAAACAGGACGATGGTGCACAGCGTGX
TGAGAGTTTAAAATCTGCACAAGCCGTaTTGGGTCAACCCTAATTGGAGATTCAAGCTCACACTGAACAAACTTTATGCGTGGAGCCTCC
CGGATTATGACTCGGTTGTCATGCTCGATGCAGATAACCTTTTCCTCCAGAAAACTGATGAACTGTTCCAATGTGGCCAGTTTTGTGCTG
ACTTCATCAATCCCTGCATCTTCCACACTGGTCTCTTCGTCTTACAGCCATCAAAAATGGCGTTCAATGACATGATTCATGACATACAGA
TTGGGAGGGAAAATCAAGACGGTGCAGACCAAGGTTTTATTGGAGGTCACTTCCCTGATTTACTTGXATCGGCCGATGTTCCACCCCTAC
TCTTAATGGTACCCAAGCTTCAGGGAAAAAACCAGGCTTCCTTTAGGAAATCAAAAGGGCGCCCTTTTATTAATTATTTTAAAACTCCCC
TTGGTCGGGACCCTGGTGGGCCCTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan