ESTScan Details for Unigene SGN-U337929

Score 
634
Direction 
Forward
Predicted Peptide Sequence 
VAKDTKKRMWEYVNSQFLLPVEGKKWVMTGLRDAWRRHKQKIKKNFFDKHSTLEDMLAKYPDGIPHHQFRQLIEYWKHPTVQAICEMNSQ
NRKKQKWRHRMGPINFARVRVALRAAKDNNEEPSKPEIFIATRTKTGKEIQADTQVAIAELKVAKIXGETADDAFRAVFGKEQPGRVRCY
GRSVTTSSLKKDEEINNLKQKHVDVITSLKEELREEXVTFIHSIAENNPGLNFQDIPGCVGSNLASPIDASSAQAVKGTNLPYSSGSAQD
SVHQKENEVTEFEFGQSKLDPLWQKMKNFLIVVISL
Predicted Coding Sequence 
GTCGCTAAGGATACTAAAAAGCGCATGTGGGAATACGTCAATTCCCAATTTCTACTTCCAGTAGAAGGAAAGAAGTGGGTGATGACTGGT
CTTCGTGATGCTTGGAGGCGACACAAGCAAAAAATTAAAAAGAATTTTTTTGATAAACACAGTACCCTTGAGGATATGCTAGCAAAATAT
CCTGATGGCATTCCACATCATCAATTCCGCCAGTTGATCGAGTATTGGAAACACCCAACTGTTCAAGCTATATGCGAGATGAATTCTCAA
AACAGGAAAAAACAAAAGTGGAGGCATCGAATGGGACCTATTAATTTTGCTAGAGTACGCGTGGCATTGCGTGCAGCCAAAGACAACAAC
GAAGAACCATCAAAGCCTGAAATATTTATTGCAACTCGTACCAAGACGGGAAAGGAAATCCAGGCTGATACCCAAGTTGCAATAGCTGAA
CTCAAAGTCGCCAAAATTXCTGGGGAAACAGCTGATGATGCATTTAGGGCAGTGTTTGGAAAGGAGCAGCCTGGTCGAGTTAGGTGCTAT
GGTAGATCAGTGACAACAAGTTCTTTGAAGAAAGATGAGGAAATTAACAATCTAAAACAAAAGCATGTCGATGTAATCACTTCTCTAAAA
GAAGAATTGAGAGAAGAAXATGTGACATTTATTCACTCAATTGCTGAAAACAACCCTGGATTGAATTTTCAAGATATACCCGGGTGTGTT
GGATCTAACCTTGCTTCACCTATTGATGCAAGTAGTGCACAAGCTGTAAAAGGCACAAATCTTCCATATTCTTCGGGGTCAGCTCAAGAT
TCCGTTCATCAAAAGGAAAATGAAGTAACTGAATTTGAATTTGGCCAGAGTAAACTCGATCCATTGTGGCAAAAGATGAAAAATTTTTTG
ATTGTTGTCATATCCCTTTGA
Edits in Original Sequence 
GGGTCGCTAAGGATACTAAAAAGCGCATGTGGGAATACGTCAATTCCCAATTTCTACTTCCAGT(5')GTCGCTAAGGATACTAAAAAGC
GCATGTGGGAATACGTCAATTCCCAATTTCTACTTCCAGTAGAAGGAAAGAAGTGGGTGATGACTGGTCTTCGTGATGCTTGGAGGCGAC
ACAAGCAAAAAATTAAAAAGAATTTTTTTGATAAACACAGTACCCTTGAGGATATGCTAGCAAAATATCCTGATGGCATTCCACATCATC
AATTCCGCCAGTTGATCGAGTATTGGAAACACCCAACTGTTCAAGCTATATGCGAGATGAATTCTCAAAACAGGAAAAAACAAAAGTGGA
GGCATCGAATGGGACCTATTAATTTTGCTAGAGTACGCGTGGCATTGCGTGCAGCCAAAGACAACAACGAAGAACCATCAAAGCCTGAAA
TATTTATTGCAACTCGTACCAAGACGGGAAAGGAAATCCAGGCTGATACCCAAGTTGCAATAGCTGAACtTCAAAGTCGCCAAAATTXCT
GGGGAAACAGCTGATGATGCATTTAGGGCAGTGTTTGGAAAGGAGCAGCCTGGTCGAGTTAGGTGCTATGGTAGATCAGTGACAACAAGT
TCTTTGAAGAAAGATGAGGAAATTAACAATCTAAAACAAAAGCATGTCGATGTAATCACTTCTCTAAAAGAAGAATTGAGAGAAGAAXAT
GTGACATTTATTCACTCAATTGCTGcAAAACAACCCTGGATTGAATTTTCAAGATATACCCGGGTGTGTTGGATCTAACCTTGCTTCACC
TATTGATGCAAGTAGTGCACAAGCTGTAAAAGGCACAAATCTTCCATATTCTTCGGGGTCAGCTCAAGATTCCGTTCATCAAAAGGAAAA
TGtAAGTAACTGAATTTGAATTTGGCCAGAGTAAACTCGATCCATTGTGGCAAAAGATGAAAAATTTTTTGATTGTTGTCATATCCCTTT
GA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan