ESTScan Details for Unigene SGN-U337930

Score 
310
Direction 
Forward
Predicted Peptide Sequence 
MXTNAGAHRGGGRSRTSGSPGLQGEXEVKITEELVXLFRYKLKSEELSRRVERFLEDXAAKDNNEEPSKPEMFIATRTKTRKEIQADTQV
AIVNFLKRIRTKFDSNLNLYIVGEFDPLNFVKYAFFFFLIFFILFKCEEVLILSXMSLSYDLKEIVLIIHLDANFFQQTELQNRQNSGET
ADDAFMAVFGKEHAGRLRYCGRLVTTKSFMKDKEIYNLIQKYANEITSLREEFREDMDIYQLIGENTLGLNFKTFPGWVD
Predicted Coding Sequence 
ATGGANACCAATGCTGGAGCTCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGGTGAAGAXGAGGTGAAGATA
ACTGAAGAACTTGTTXCTCTTTTCCGATACAAGCTGAAGAGTGAAGAACTGAGCAGAAGAGTTGAACGATTCCTTGAAGATGXTGCAGCC
AAAGACAACAATGAAGAACCATCAAAGCCTGAAATGTTTATAGCAACTCGTACCAAGACAAGAAAGGAAATCCAGGCCGATACCCAAGTT
GCAATAGTAAATTTTTTAAAGAGGATTAGAACGAAATTTGATTCAAACTTAAATTTATATATTGTGGGGGAGTTTGATCCATTGAATTTT
GTCAAGTACGCCTTCTTTTTCTTTCTCATTTTCTTCATTTTGTTCAAGTGCGAGGAGGTATTAATTCTTAGTCXGATGTCTCTATCATAT
GACTTGAAAGAAATAGTACTCATAATTCACTTGGATGCCAATTTTTTTCAACAGACTGAACTTCAAAATCGCCAAAATTCAGGGGAAACA
GCTGATGATGCATTTATGGCAGTGTTTGGAAAGGAGCATGCTGGTCGACTTAGATACTGTGGTAGATTAGTGACCACAAAGTCTTTTATG
AAAGATAAGGAAATTTACAATTTAATACAAAAATATGCCAATGAAATCACTTCTCTTAGGGAAGAATTCAGAGAAGATATGGACATTTAT
CAACTCATTGGTGAAAACACCCTTGGATTGAATTTCAAGACATTCCCAGGGTGGGTGGATTAA
Edits in Original Sequence 
(5')ATGGANACCAATGCTGGAGCTcCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGGTGAAGAXGAGGTGA
AGATAACTGAAGAACTTGTTXCTCTTTTCCGATACAAGCTGAAGAGTcGAAGAACTGAGCAGAAGAGTTGAACGATTCCTTGAAGATGXT
GCAGCCAAAGACAACAATGAAGAACCATCAAAGCCTGAAATGTTTATAGCAACTCGTACCAAGACAAGAAAGGAAATCCAGGCCGATACC
CAAGTTGCAATAGTAAATTTTTTAAAGAGGATTAGAACGAAATTTGATTCAAACTTAAATTTATATATTGTGGGGGAGTTTGAtTCCATT
GAATTTTGTCAAGTACGCCTTCTTTTTCTTTCTCATTTTCTTCATTTTGTTCAAGTGCGAGGAGGTATTAATTCTTAGTCXGATGTCTCT
ATCATATGACTTGAAAtGAAATAGTACTCATAATTCACTaTGGATGCCAATTTTTTTCAACAGACTGAACTTCAAAATCGCCAAAATTCA
GGGGAAACAGCTGATGATGCATTTATGGCAGTGTTTGGAAAGGAGCATGCTGGTCGACTTAGATACTGTGGTAGATTAGTGACCACAAAG
TCTTTTATGAAAGATAAGGAAATTTACAATTTAATACAAAAATATGCCAATGAAATCACTTCTCTTAGGGAAGAATTCAGAGAAGATATG
cGACATTTATCAACTCATTGGTGAAAACACCCTTGGATTGAATTTCAAGACATTCCCAGGGTGGGTGGATTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan