ESTScan Details for Unigene SGN-U338002

Score 
388
Direction 
Reverse
Predicted Peptide Sequence 
GLTQPQLASFQFEPVRTTTEVEGICIRGEDLKFFAVQFKRLHSMKLQHAFRVLSSSVEKWGACFIQVAWRRYKKKKMEYELALQESYYYN
QDPNDEGNYNEQSFDDAGPEQPLVASGSRGSQQLGATILAKRFATNTRRGIEQKMADSSSSLKMPKLFKPDEPDXFSAFLAAANLVSGPK
ITLVSXILDVAPILISSSPSLFNFLGXPAMNTHTRRIISQLALQGIYTTVFTTVYVQKNGLAS
Predicted Coding Sequence 
XATGGCCTAACTCAACCGCAGTTGGCCAGTTTCCAATTTGAACCAGTAAGGACCACTACGGAAGTTGAAGGCATTTGCATTCGAGGTGAA
GACCTGAAATTTTTTGCAGTTCAATTTAAACGTCTTCACAGCATGAAGCTCCAGCATGCATTTAGGGTACTATCTTCATCAGTGGAGAAA
TGGGGTGCTTGTTTTATACAGGTTGCATGGAGAAGGTATAAGAAGAAAAAGATGGAATACGAGTTGGCTCTACAAGAGAGCTATTATTAT
AATCAAGATCCTAATGATGAGGGTAACTACAATGAGCAAAGTTTTGATGACGCTGGTCCTGAGCAACCGTTAGTAGCCAGTGGTTCTCGT
GGTTCCCAACAACTTGGAGCTACAATTTTGGCCAAACGATTTGCTACTAATACGAGAAGAGGAATAGAACAGAAGATGGCTGATTCTTCT
TCTAGCTTAAAAATGCCCAAGCTGTTTAAGCCAGATGAGCCTGATXTTTTCTCTGCATTTTTAGCAGCAGCAAATCTGGTCTCTGGTCCA
AAAATTACTCTGGTATCTGAXATTCTTGACGTTGCTCCGATTCTTATCTCTTCTTCTCCATCTCTATTTAATTTTCTCGGTXCTCCAGCA
ATGAATACTCATACACGACGGATCATTTCTCAGCTTGCACTTCAAGGTATTTATACTACGGTCTTTACTACTGTTTATGTGCAAAAGAAT
GGACTGGCATCTTAA
Edits in Original Sequence 
(5')XATGGCCTAACTCAACCGCAGTTGGCCAGTTTCCAATTTGAACCAGTAAGGACCACTACGGAAGTTGAAGGCATTTGCATTCGAGG
TGAAGACCTGAAATTTTTTGCAGTTCAATTTAAACGTCTTCACAGCATGAAGCTCCAGCATGCATTTAGGGTACTATCTTCATCAGTGGA
GAAcATGGGGTGCTTGTTTTATACAGGTTGCATGGAGAAGGTATAAGAAGAAAAAGATGGAATACGAGTTGGCTCTACAAGAGAGCTATT
ATTATAATCAAGATCCTAATGATGAGGGTAACTACAATGAGCAAAGTTTTGATGACGCTGGTCCTGAGCAACCGTTAGTAGCCAGTGGTT
CTCGTGGTTCCCAACAACTTGGAGCTACAATTTTGGCCAAACGATTTGCTACTAATACGAGAAGAGGAATAGAACAGAAGATGGCTGATT
CTTCTTCTAGCTTAAAAATGCCCAAGCTGTTTAAGCCAGATGAGCCTGATXTTTTCTCTGCATTTTTAGCAGCAGCAAATCTGGTCTCTG
GTCCAAAAATTACTCTGGTATCTGAXATTCTTGACGTTGCTCCGATTCTTATCTCTTCTTCTCCATCTCTATTTAATTTTCTCGGTXCTC
CAGCAATGAATACTCATACACGACGGATCATTTCTCAGCTTcGCACTTCAAGGTATTTATACTACGGTCTTTACTACTGTTTATGTGCAA
AAGAATGGACTGGCATCTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan