Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U338005

Score 
545
Direction 
Forward
Predicted Peptide Sequence 
LAGAPRGGGRSRTSGSPGLQVASTVVKPLIIAGLTNFMENSSNKETAMRLREVAEGAVKAIGLGFDIVDDLRLKFCKDYQLISVDHDQVR
DISIPGGILVQNVPKSINCDKGERMRFTSDILSFSQYRQWRVSTREREEGDAGNQGNLAINESEMSERFNQDLSLSGKIPSGHFNAAFEY
TTCWQKDAAYTKALAFDGVFITLYNIALEKAQVVLRDHVKQAIPSSWDPVALTRFIEKYGTHVIVGVKMGGKDXVYVKQQYSFTLQPADI
QKKLKEVADXKIWACNVXSSTTLLAYSEHSCLLX
Predicted Coding Sequence 
XTATTAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGTTGCTTCTACAGTTGTTAAACCATTA
ATAATAGCXGGTTTAACGAATTTCATGGAGAACAGTAGTAACAAAGAGACGGCGATGAGACTTAGAGAGGTGGCCGAAGGAGCAGTAAAG
GCGATTGGGTTAGGGTTTGATATAGTGGATGATTTGAGGTTGAAGTTTTGTAAGGATTATCAGTTGATCTCTGTTGACCATGATCAGGTG
CGAGACATTTCAATTCCTGGTGGAATTTTGGTTCAAAATGTTCCCAAATCTATCAATTGCGATAAAGGCGAACGCATGAGATTTACTTCT
GATATTCTCTCTTTCTCCCAGTATAGGCAATGGAGGGTCTCAACAAGAGAAAGGGAAGAAGGGGATGCTGGAAATCAAGGGAATTTGGCA
ATCAATGAATCTGAGATGTCCGAGCGATTTAATCAGGACCTATCCCTTTCTGGTAAGATTCCATCGGGCCATTTCAATGCTGCTTTTGAA
TATACCACTTGTTGGCAAAAAGACGCTGCCTACACGAAAGCTCTTGCTTTTGATGGGGTCTTCATAACACTCTATAACATTGCATTAGAG
AAGGCTCAAGTTGTACTGCGTGATCATGTTAAACAAGCAATTCCTTCATCTTGGGATCCAGTAGCATTGACAAGGTTTATTGAGAAATAT
GGTACCCATGTTATTGTTGGTGTAAAGATGGGTGGAAAGGATGNTGTATATGTCAAACAGCAATATTCTTTCACACTTCAGCCTGCTGAT
ATACAGAAAAAGTTGAAAGAAGTGGCAGACGAXAAGATTTGGGCATGCAATGTANCATCCAGCACTACTTTGCTAGCTTATAGTGAACAC
AGCTGCCTCTTAGXX
Edits in Original Sequence 
(5')XTATTAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGTTGCTTCTACAGTTGTTAAACC
ATTAATAATAGCXGGTTTAACGAATTTCATGGAGAACAGTAGTAACAAAGAGACGGCGATGAGACTTAGAGAGGTGGCCGAAGGAGCAGT
AAAGGCGATTGGGTTAGGGTTTGATATAGTGGATGATTTGAGGTTGAAGTTTTGTAAGGATTATCAGTTGATCTCTGTTGACCATGATCA
GGTGCGAGACATTTCAATTCCTGGTGGAATTTTGGTTCAAAATGTTCCCAAATCTATCAATTGCGATAAAGGCGAACGCATGAGATTTAC
TTCTGATATTCTCTCTTTCTCCCAGTATAGGCAATGGAGGGTCTCAACAAGAGAAAGGGAAGAAGGGGATGCTGGAAATCAAGGGAATTT
GGCAATCAATGAATCTGAGATGTCCGAGCGATTTAATCAGGACCTATCCCTTTCTGGTAAGATTCCATCGGGCCATTTCAATGCTGCTTT
TGAATATACCACTTGTTGGCAAAAAGACGCTGCCTACACGAAAGCTCTTGCTTTTGATGGGGTCTTCATAACACTCTATAACATTGCATT
AGAGAAGGCTCAAGTTGTACTGCGTGATCATGTTAAACAAGCAATTCCTTCATCTTGGGATCCAGTAGCATTGACAAGGTTTATTGAGAA
ATATGGTACCCATGTTATTGTTGGTGTAAAGATGGGTGGAAAGGATGNTGTATATGTCAAACAGCAATATTCTTTCACACTTCAGCCTGC
TGATATACAGAAAAAGTTGAAAGAAGTGGCAGACGAXAAGATTTGGGCATGCAATGTANCATCCAGCACTACTTTGCTAGCTTATAGTGA
ACACAGCTGCCTCTTAGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan