ESTScan Details for Unigene SGN-U338050

Score 
333
Direction 
Forward
Predicted Peptide Sequence 
MQQDSVSEQEPDESESEPDFVELDPTGRYGRYKEVLGKGAFKKVYRAFDELEGIEVAWNQVKVADLLRNEVDLERLYSEVHLLKTLKHKN
IIKFYNSWVDTKTENINIITEIFTSGNLRQYRKKHKKVDLRALKNWSRQILEGLSFYIVNDPPDFIVNLSVKIFWQWXPKGGGX
Predicted Coding Sequence 
ATGCAGCAGGATTCAGTGTCGGAGCAGGAACCGGATGAATCTGAATCTGAGCCCGACTTCGTGGAGCTCGATCCTACTGGTCGTTACGGA
CGGTACAAAGAGGTTCTGGGAAAAGGAGCATTTAAGAAAGTATATCGAGCGTTTGATGAACTGGAAGGAATAGAAGTAGCTTGGAATCAG
GTTAAAGTTGCTGATCTATTGAGGAATGAAGTGGACTTGGAGCGTCTTTATTCTGAAGTTCATTTGCTTAAAACCCTCAAGCACAAGAAT
ATCATCAAATTTTACAACTCTTGGGTTGACACAAAGACTGAGAATATCAACATCATTACTGAAATATTCACTTCTGGGAATTTAAGACAA
TACCGCAAAAAACATAAGAAGGTTGATTTGCGAGCACTCAAGAATTGGTCTCGGCAGATATTGGAGGGACTTTCATTCTACATTGTCAAC
GACCCTCCAGATTTCATCGTGAACTTAAGTGTGAAAATTTTTTGGCAATGGGNACCCAAGGGAGGGGGAGXX
Edits in Original Sequence 
CGATTCCTCACTCACCAAAACCTACGTAAAGTCCTATATACTGCGTATTTGAAGGACAACAGAGTAATCAAAATTGTTGCTGAATTGTGG
ATGTTACTGTAGAAATTGGGAGATTTTTTTTTGACTGATTTGATTCAATTGAAGAGCTAGGGTTCTGGATTTTGTGTTATTTCGATTCAT
TGATCGAAGAGAATGCAGCAGGATTCAGTGTCGGAGCAGGAACCGGATGAATCTGAATCTGAGCCCGACTTCGTGGAGCTCGATCCTACT
GGTCGTTACGGACGGTAC
(5')ATGCAGCAGGATTCAGTGTCGGAGCAGGAACCGGATGAATCTGAATCTGAGCCCGACTTCGTGGAGCT
CGATCCTACTGGTCGTTACGGACGGTACAAAGAGGTTCTGGGAAAAGGAGCATTTAAGAAAGTATATCGAGCGTTTGATGAACTGGAAGG
AATAGAAGTAGCTTGGAATCAGGTTAAAGTTGCTGATCTATTGAGGAATGAAGTGGACTTGGAGCGTCTTTATTCTGAAGTTCATTTGCT
TAAAACCCTCAAGCACAAGAATATCATCAAATTTTACAACTCTTGGGTTGACACAAAGACTGAGAATATCAACATCATTACTGAAATATT
CACTTCTGGGAATTTAAGACAATACCGCAAAAAACATAAGAAGGTTGATTTGCGAGCACTCAAGAATTGGTCTCGGCAGATATTGGAGGG
ACTTTCATaTCTACATTGTCAACGACCCTCCAGtATTTCATCGTGAACTTAAGTGTGAAAATTTTTTGGCAATGGGNACCCAAGGGAGGG
GGAGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan