ESTScan Details for Unigene SGN-U338069

Score 
150
Direction 
Reverse
Predicted Peptide Sequence 
GKGQRLETEKLGKTVKTGRQARALRIDSKQVQQRSKRNIKSGVKKGKLLXKTDGKQFGKKGIINKAPVFSNVKNDMLIAQDKICGPVQSI
LKFKDLDEVVRRDNSSRYGLQVGVLSPHIDTANTLARALRVGTVWINCFDTFDATIPFGGYKMSGQRREKEEYGLKNYLQVKAVVTPLKN
PAWL
Predicted Coding Sequence 
GGCAAAGGCCAGCGCCTTGAAACAGAGAAGTTAGGGAAGACGGTTAAAACAGGGCGACAAGCCAGGGCCCTCAGGATTGATTCAAAACAG
GTTCAACAAAGATCAAAAAGGAACATAAAATCTGGTGTTAAAAAAGGGAAGCTACTTXTTAAAACTGACGGTAAGCAATTTGGTAAAAAG
GGGATAATAAATAAGGCCCCCGTTTTCTCTAATGTTAAGAATGATATGCTGATTGCACAAGATAAAATTTGTGGTCCAGTGCAGTCCATC
TTAAAATTTAAGGATCTTGATGAAGTGGTACGGAGAGATAATAGTTCTCGGTATGGTCTACAGGTGGGAGTACTTTCACCGCACATCGAC
ACTGCAAACACGTTGGCACGAGCCTTGAGAGTTGGGACGGTATGGATTAATTGCTTTGATACGTTTGATGCTACAATTCCTTTTGGTGGC
TATAAGATGAGTGGTCAGAGAAGAGAAAAGGAAGAATACGGTCTCAAAAATTACTTGCAAGTAAAGGCAGTTGTGACACCATTGAAGAAT
CCAGCATGGTTATAA
Edits in Original Sequence 
AGTTCTCGGTATGGTCTACAGGTGGGAGTACTTTCACCGCACATCGACACTGCAAACACGTTGGCACGAGCCTTGAGAGTTGGGACGGTA
TGGATTAATTGCTTTGATACGTTTGATGCTACAATTCCTTTTGGTGGCTATAAGATGAGTGGTCAGAGAAGAGAAAAGGAAGAAT
(5')G
GCAAAGGCCAGCGCCTTGAAACAGAGAAGTTAGGGAAGACGGTTAAAACAGGGCGACAAGCCAGGGCCCTCAGGATTGATTCAAAACAGG
TTCAACAAAGATCAAAAAGGAACATAAAATCTGGTGTTAAAAAAGGGAAGCTACTTXTTAAAACTGACGGTAAGCAATTTGGTAAAAAGG
GGATAATAAATAAgGGCCCCCGTTTTCTCTAATGTTAAGAATGATATGCTGATTGCACAAGATAAAATTTGTGGTCCAGTGCAGTCCATC
TTAAAATTTAAGGATCTTGATGAAGTGGTACGGAGAGATAATAGTTCTCGGTATGGTCTACAGGTGGGAGTACTTTCACCGCACATCGAC
ACTGCAAACACGTTGGCACGAGCCTTGAGAGTTGGGACGGTATGGATTAATTGCTTTGATACGTTTGATGCTACAATTCCTTTTGGTGGC
TATAAGATGAGTGGTCAGAGAAGAGAAAAGGAAGAATACGGTCTCAAAAATTACTTGCAAGTAAAGGCAGTTGTGACACCATTGAAGAAT
CCAGCATGGTTATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan