ESTScan Details for Unigene SGN-U338104

Score 
157
Direction 
Forward
Predicted Peptide Sequence 
MALSSPSFFCGLATLSKETDAVTSFGVRPXVVTTNCCKQGEFQYVLTDYVSPNQFPASRTDRQSTILHIQDSSDLASALARFRINNSNPQ
LFDSLKWLFSKFMVEIVVAFSXLSGVGFCMCFDSESGYLIFWXIYNLLSEPLNIHGSFVLAPFRHGDTLKVQDMNVILRYFGKLNRRPEL
CQVLSA
Predicted Coding Sequence 
ATGGCTCTTTCATCACCTTCATTCTTTTGTGGTTTGGCAACTCTTTCCAAAGAAACAGACGCAGTCACAAGTTTCGGTGTTCGACCTXCT
GTCGTAACTACAAATTGTTGTAAGCAAGGCGAATTTCAGTATGTGCTCACGGATTATGTCTCTCCAAATCAGTTTCCTGCTTCCCGTACT
GATAGACAGTCAACAATTCTTCATATTCAGGACTCATCTGACTTGGCTTCTGCTCTTGCAAGGTTTCGAATTAACAACTCTAATCCTCAA
TTATTCGATTCCTTGAAATGGCTATTTTCGAAATTCATGGTTGAAATTGTAGTTGCTTTTAGTXATCTAAGTGGTGTTGGTTTTTGTATG
TGCTTCGACTCTGAAAGTGGATACCTCATTTTCTGGGXTATTTACAACCTTCTTTCGGAACCTTTGAACATCCATGGTTCATTTGTACTA
GCTCCTTTCAGGCATGGTGATACACTTAAAGTACAAGATATGAATGTGATTTTGCGCTATTTTGGGAAGCTAAATAGAAGACCGGAGCTT
TGTCAGGTTCTGTCAGCA
Edits in Original Sequence 
TGGGTATTGAAAAATTGGTGGTTTGTTGTATCTGAGTCGATAATGGCTCTTTCATCACCTTCATTCTTTTGTGGTTTGGCAACTCTTTCC
AACAGAAACAGACG
(5')ATGGCTCTTTCATCACCTTCATTCTTTTGTGGTTTGGCAACTCTTTCCAAcAGAAACAGACGCAGTCACAAG
TTTCGGTGTTCGACCTXCTGTCGTAACTACAAATTGTTGTAAGCAAGGCGAATTTCAGTATGTGCTCACGGATTATGTCTCTCCAAATCA
GTTTCCTGCTTCCCGTACTGATAGACAGTCAACAATTCTTCATATTCAGGACTCATCTGACTTGGCTTCTGCTCTTGCAAGGTTTCGAAT
TAACAAgCTCTAATCCTCAATTATTCGATTCCTTGAAATGGCTATTTTCGAAATTCATGGTTGAAATTGTAGTTGCTTTTAGTXATCTAA
GTGGTGTTGGTTTTTGTATGTGCTTCGACTCTGAAAGTGGATACCTCATTTTCTGGGXTATTTACAACCTTCTTTCGGAACCTTTaGAAC
ATCCATGGTTCATTTGTACTAGCTCCTTTCAGGCATGGTGATACACTTAAAGTACAAGATATGAATGTGATTTTGCGCTATTTTGGGAAG
CTAAATAGAAGACCGGAGCTTTGTCAGGTTCTGTCAGCA(3')GAATTCTTTGTATTTTGTTGTATTAATCAATGTGTGCACAAGATGGT
CTGAACATCCCCGTTATAAAAATGATATTTTATTGTAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan