Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U338106

Score 
247
Direction 
Forward
Predicted Peptide Sequence 
PTETDAVTSFGVRPXVVTTNCCKQGEFQYVLTDYVSPNQFPASRTDRQSTILHIQDSSDLASALARHGDTLKVQDMNVILRYFGKLNRRP
ELCQVFEWMQQNQKINVASYSSYVKFMGKSLSCVDAVEMYRDIKDRSIKFNVSVCNAFLXFPDKKRKIGEQSQTVYSNEGDGLVPDVFTY
STLLAGCAKVNGGYYKALELVQEMMSNGLGMDSVTYGSLLSVCASHKECNEAAKYFQKNEDEX
Predicted Coding Sequence 
CCAACAGAAACAGACGCAGTCACAAGTTTCGGTGTTCGACCTXCTGTCGTAACTACAAATTGTTGTAAGCAAGGCGAATTTCAGTATGTG
CTCACGGATTATGTCTCTCCAAATCAGTTTCCTGCTTCCCGTACTGATAGACAGTCAACAATTCTTCATATTCAGGACTCATCTGACTTG
GCTTCTGCTCTTGCAAGGCATGGTGATACACTTAAAGTACAAGATATGAATGTGATTTTGCGCTATTTTGGGAAGCTAAATAGAAGACCG
GAGCTTTGTCAGGTGTTTGAATGGATGCAGCAGAATCAGAAGATCAATGTTGCATCATACAGTAGTTATGTAAAGTTCATGGGGAAGAGC
CTCAGTTGTGTTGATGCTGTAGAAATGTACAGAGACATCAAAGACAGGTCGATAAAGTTTAATGTCTCAGTCTGTAATGCATTTCTTAGX
TTCCCTGATAAAAAACGGAAAATCGGAGAGCAGTCTCAAACTGTTTACTCAAATGAAGGAGATGGTTTAGTACCAGATGTATTCACATAT
AGCACGCTTCTTGCAGGCTGTGCCAAAGTAAACGGTGGATACTATAAGGCACTAGAGCTGGTTCAGGAGATGATGTCTAATGGACTGGGA
ATGGATAGTGTGACTTATGGGTCACTCCTTTCTGTCTGTGCTTCACATAAAGAGTGCAATGAAGCTGCAAAGTACTTTCAGAAGAATGAA
GATGAAGXX
Edits in Original Sequence 
GCTCTTTCATCACCTTCATTCTTTTGTGGTTTGGCAACTCTTTCCAACAGAAACAGACGCAGTCACAAGTTTCGGTGTTCGACCTCTGTC
GTAACTACAAATTGTTGTAAGCAAGGCG
(5')CCAACAGAAACAGACGCAGTCACAAGTTTCGGTGTTCGACCTXCTGTCGTAACTACAA
ATTGTTGTAAGCAAGGCGAATTTCAGTATGTGCTCACGGATTATGTCTCTCCAAATCAGTTTCCTGCTTCCCGTACTGATAGACAGTCAA
CAATTCTTCATATTCAGGACTCATCTGACTTGGCTTCTGCTCTTGCAAGGCATGGTGATACACTTAAAGTACAAGATATGAATGTGATTT
TGCGCTATTTTGGGAAGCTAAATAGAAGACCGGAGCTTTGTCAGGTGTTTGAATGGATGCAGCAGAATCAGAAGATCAATGTTGCATCAT
ACAGTAGTTATGTAAAGTTCATGGGGAAGAGCCTCAGTTGTGTTGATGCTGTAGAAATGTACAGAGACATCAAAGACAGGTCGATAAAGT
TTAATGTCTCAGTCTGTAATGCATTTCTTAGXTTCCCTGATAAAAAACGGAAAATCGGAGAGCAGTCTCAAACTGTTTACTCAAATGAAG
cGAGATGGTTTAGTACCAGATGTATTCACATATAGCACGCTTCTTGCAGGCTGTGCCAAAGTAAACGGTGGATACTATAAGGCACTAGAG
CTGGTTCAGGAGATGATGTCTAATGGACTGGGAATGGATAGTGTGACTTATGGGTCACTCCTTTCTGTCTGTGCTTCACATAAAGAGTGC
AATGAAGCTGCAAAGTACTTTCAGAAGAATGAAGATGAAGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan