ESTScan Details for Unigene SGN-U338174

Score 
-193
Direction 
Reverse
Predicted Peptide Sequence 
GFPVXAGKVSEPGERPEGKFPRGKTPPGIFIVPVRVFATFDLERRIFXDARQGGGAYGKTPATAAFLRFLAFCWPFAHMFFPALSPDSVD
TRITPLSELIPLAAAERPSAAESVSEEAEERPIRKPPLPAVGRFINAAGTTGFPTGKRAVSATQLMELAHSLGTPGFTLYASGRMLCGIV
TDNNFTQETAMTMITPSSKLTLTKGNKSWSSTAVAAALELVDPRAAGIRHEGGSCPCLAAMTLPQVLNEIQECKKAYPNAFIRCLAFDNV
KQAQCMAFLIQKPAP
Predicted Coding Sequence 
XXCGGTTTTCCGGTTAAXGCCGGCAAGGTTTCGGAACCAGGAGAGCGCCCCGAAGGGAAGTTCCCCAGGGGGAAAACCCCXCCGGGTATC
TTTATAGTCCCCGTCCGGGTTTTCGCCACCTTTGACTTGGAGCGTCGGATTTTTGXTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAA
ACGCCAGCAACXGCGGCTTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTG
GATACCCGTATTACCCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAA
GAGCGCCCAATACGCAAACCGCCTCTCCCCGCCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCA
GTGAGCGCAACGCAATTAATGGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCCGTATGTTGTGTGGAATT
GTGACGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGG
AGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCGGGCTGCAGGAATTCGGCACGAGGGTGGAAGTTGCCCATGTTTGGCT
GCAATGACTCTTCCXCAGGTTCTCAATGAAATCCAAGAATGCAAGAAAGCTTACCCAAATGCTTTTATTCGTTGCTTGGCGTTTGATAAT
GTTAAGCAGGCACAGTGCATGGCCTTCCTCATTCAGAAACCTGCACCATAA
Edits in Original Sequence 
(5')XXCGGTTTTCCGGTTAAXGCCGGCAAGGTTTCGGAACCAGGAGAGCGCCCCGAAGGGAAGTTCCCCAGGGGGAAAACCCCXCCGGG
TATCTTTATAGTCCCCGTCCGGGTTTTCGCCACCTTTGACTTGGAGCGTCGGATTTTTGXTGATGCTCGTCAGGGGGGCGGAGCCTATGG
AAAAACGCCAGCAACXGCGGCTTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTC
TGTGGATACCCGTATTACCgCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAG
CGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCgCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAG
CGGGCAGTGAGCGCAACGCAATTAATGtGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCtCGTATGTTGT
GTGGAATTGTGAgCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAAC
AAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATcCCCCGGGCTGCAGGAATTCGGCACGAGGGTGGAAGTTGCCC
ATGTTTGGCTGCAATGACTCTTCCXCAGGTTCTCAATGAAATCCAAGAATGCAAGAAAGCTTACCCAAATGCTTTTATTCGTTGCTTGGC
GTTTGATAATGTTAAGCAGGCACAGTGCATGGCCTTCCTCATTCAGAAACCTGCACCATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan