ESTScan Details for Unigene SGN-U338206

Score 
-137
Direction 
Forward
Predicted Peptide Sequence 
VELQLLFPLVRVNFKLGVIMDISVSXGEIVIRSPFHTTYEPEAXSVKPAVPNDELTHINCVALTARFPVGKPVVPPAXNESANAAGRGGL
HIVPLFGSSLTDPAANKVARLREGGXKKFKGRIPPSGKPGTPTEISYTHAATLLPLIDQWACFSSFFLLPFPX
Predicted Coding Sequence 
GTGGAGCTCCAGCTTTTGTTCCCTTTAGTGAGGGTTAATTTCAAGCTTGGCGTAATCATGGACATATCTGTTTCCXTGGGTGAAATTGTT
ATCCGCTCACCTTTCCACACAACATACGAGCCGGAAGCATAAAGTGTAAAGCCTGCGGTGCCTAATGATGAGCTAACTCACATTAATTGC
GTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCCCCTGCAXTTAATGAATCGGCCAACGCXGCGGGGAGAGGCGGTTTG
CATATTGTGCCCCTCTTCGGTTCTTCGCTCACTGACCCCGCTGCAAATAAGGTGGCACGACTCCGAGAAGGGGGAXTTAAAAAATTCAAG
GGGAGAATACCGCCATCAGGAAAACCGGGCACACCCACCGAAATATCCTATACCCACGCAGCAACCCTTTTGCCACTAATCGATCAATGG
GCTTGTTTCTCGTCCTTCTTCCTCCTTCCATTCCCACNTTAA
Edits in Original Sequence 
GGTACCGGGCCCCCCCCCGAGCTTTTTTGTTTATTTTTTCTTTTGACCCCAGCCTAATGGAAATGTATTGGAGTATTTACAAATGTGCTA
GTGAAGTAGGGTATGCTAACTATAGGGATTTGTGGATCTTTGAAAATTGGACTCTTTCATCTCTGAAATTATCAAAGAATTATTGGTTTT
TAAAATGTAACATCTTTTCTATTTCTTTTATGTGTTACCACTTTCATTTACACGATTAACTAAACTTATAA
(5')GTGGAGCTCCAGCTT
TTGTTCCCTTTAGTGAGGGTTAATTTCAAGCTTGGCGTAATCATGGACATATCTGTTTCCXTGGGTGAAATTGTTATCCGCTCACCTTTC
CACACAACATACGAGCCGGAAGCATAAAGTGTAAAGCCTGCGGTGCCTAATGAgTGAGCTAACTCACATTAATTGCGTTGCGCTCACTGC
CCGCTTTCCAGTCGGGAAACCTGTCGTGCCCCCTGCAXTTAATGAATCGGCCAACGCXGCGGGGAGAGGCGGTTTGCATATTGTGCCCCT
CTTCGGTTCTTCGCTCACTGACCCCGCTGCAAATAAGGTGGCACGACTCCGAGAAGGGGGAXTTAAAAAATTCAAGGGGAGAATACCGCC
ATCAGGAAtAACCGGGCACACCCACCGAAATATCCTATACCCACGCAGCAACCCTTTTGCCACTAATCGATCAATGGGCTTGTTTCTCGT
CCTTCTTCgCTCCTTCCATTCCCACNTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan