ESTScan Details for Unigene SGN-U338263

Score 
232
Direction 
Reverse
Predicted Peptide Sequence 
MSQQELXKKKHKKKKNKTFVKSGSLSFLANKKRRLLTINEIVQAIECEKGHMLKLIRVQQTVAPNLKQIDNSIEKQHVKEQPVGEIHFDD
QVQMNYVTPKQMINLKNKVMYKLRNLLNVSMIANYXFLYFLIAEYVIAQLKNAGLINPIIMEALFIPSPIEFTYVQGAEQGDEIEEGDES
SSEDLT
Predicted Coding Sequence 
ATGAGTCAACAAGAACTTXTCAAAAAGAAACACAAGAAGAAAAAAAACAAGACATTTGTTAAATCGGGATCATTATCATTCTTGGCAAAT
AAGAAACGGCGGTTATTGACAATAAATGAAATTGTTCAAGCTATAGAGTGCGAGAAAGGACATATGCTTAAATTAATAAGAGTACAACAA
ACAGTAGCCCCAAATCTGAAGCAAATAGACAATTCTATAGAGAAGCAGCATGTCAAGGAGCAGCCTGTCGGAGAGATACATTTCGATGAT
CAAGTGCAAATGAATTATGTCACTCCTAAACAGATGATCAACCTAAAGAATAAGGTAATGTACAAGCTTAGAAACCTATTAAATGTATCC
ATGATTGCTAATTATXATTTCTTGTATTTTCTTATAGCTGAATATGTAATTGCACAACTTAAGAATGCCGGATTAATTAATCCTATCATA
ATGGAAGCATTGTTCATTCCTTCACCAATAGAATTTACTTATGTTCAAGGGGCCGAGCAAGGTGATGAAATTGAAGAAGGCGATGAAAGC
AGTAGTGAAGACTTGACATAG
Edits in Original Sequence 
ATCATTATCATTCTTGGCAAATAAGAAACGGCGGTTATTGACAATAAATGAAATTGTTCAAGCTA(5')ATGAGTCAACAAGAACTTXTC
AAAAAGAAACACAAGAAGAAAAAAAACAAGACATTTGTTAAATCGGGATCATTATCATTCTTGGCAAATAAGAAACGGCGGTTATTGACA
ATAAATGAAATTGTTCAAGCTATAGAGTGCGAGAAAGGACATATGCTTAAATTAATAAGAGTACAACAAACAGTAGCCCCAtAATCTGAA
GCAAATAGACAATTCTATAGAGAAGCAGCATGTCAAGGAGCAGCCTGTCGGAGAGATACATTTCGATGATCAAGTGCAAATGAATTATGT
CACTCCtTAAACAGATGATCAACCTAAAGAATAAGGTAATGTACAAGCTTAGAAACCTATTAAATGTATCCATGATTGCTAATTATXATT
TCTTGTATTTTCTTATAGCTGAATATGTAATTGCACAACTTAAGAATGCCGGATTAATTAATCCTATCATAATGGAAGCATTGTTCATTC
CTTCACCAATAGAATTTACTTATGTTCAAGGGGCCGAGCAAGGTGATGAAATTGAAGAAGGCGATGAAAGCAGTAGTGAAGACTTGACAT
AG(3')GCCACATGGATCTTGAATCATAATTTTGGTTATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan