ESTScan Details for Unigene SGN-U338284

Score 
457
Direction 
Forward
Predicted Peptide Sequence 
MSSPWPFVAWGMDVISSIESTASNGHRFILVAIDYFTKWVEATPYKSVTKKVVVDFVRNNLICRFGVPESIITDNGANLNSHLMKQIYEQ
FKLFIESXTAYRPQMNRAVEAANKNIKKILRKMIDKQRGWHEMLPYAFLGYRTTVRTSTWATPYLLVYGTEAVVPVEVEIPSLRIIQEAE
LSNAEWLSKQIDQLALIDKKRIVAFAMASCTDRXMTRAFHKRVRARNFEVGQLVLKRIFPHQDEYKEKFALTWQGPYLVRKILSGGALGL
VDPEGDVSPKPINSESXQENTMPEISFGIFSGILGNDPVCLGFISKFLSPLGKEQRFEPEFSKIEKL
Predicted Coding Sequence 
ATGAGTTCACCTTGGCCATTTGTAGCTTGGGGAATGGATGTCATCAGTTCTATAGAGTCTACCGCTTCTAATGGACATAGATTCATTTTG
GTTGCCATTGATTATTTCACCAAGTGGGTGGAAGCAACCCCTTACAAGTCGGTAACCAAGAAAGTGGTGGTCGATTTTGTTCGCAACAAT
CTGATATGCAGATTTGGAGTTCCAGAATCCATCATTACTGATAACGGGGCAAATCTCAACAGTCATTTGATGAAACAGATATATGAACAA
TTTAAGTTATTCATCGAAAGTXCAACTGCTTATCGCCCCCAAATGAACAGAGCTGTAGAAGCCGCCAACAAAAATATCAAGAAGATTTTG
AGGAAAATGATTGACAAACAGCGGGGTTGGCATGAAATGTTGCCATATGCTTTTCTAGGTTATCGAACGACGGTCAGAACATCGACTTGG
GCTACTCCATACTTGCTAGTATATGGAACAGAGGCAGTCGTGCCTGTTGAAGTCGAGATACCGTCATTGCGGATCATCCAAGAAGCTGAA
TTAAGTAACGCCGAATGGCTTAGCAAACAGATTGATCAACTAGCCTTAATTGATAAGAAGAGAATAGTTGCGTTTGCCATGGCAAGTTGT
ACAGACAGAGAXATGACTCGCGCTTTTCACAAAAGAGTAAGAGCCAGGAATTTTGAAGTTGGTCAGTTGGTTCTTAAGCGTATTTTTCCT
CATCAAGACGAGTACAAAGAAAAGTTCGCGCTTACCTGGCAGGGTCCTTACTTGGTTCGTAAAATATTATCGGGAGGTGCTTTGGGTCTT
GTTGACCCGGAAGGCGATGTATCGCCCAAACCTATCAACTCAGAATCTGXTCAAGAGAATACTATGCCTGAAATTTCATTTGGCATTTTT
TCGGGTATTCTTGGAAACGATCCGGTTTGCCTGGGATTTATTTCCAAATTTTTATCCCCCCTGGGAAAGGAACAACGTTTCGAACCTGAA
TTCTCCAAAATTGAAAAACTATAG
Edits in Original Sequence 
CGTTTTGAGACGGGTGCCACCTCACGAACTTAACGCTATGAGTTCACCTTGGCCATTTGTAGCTTGGGGAATGGATGTCATCAGTTCTAT
AGAGTCTACCGCT
(5')ATGAGTTCACCTTGGCCATTTGTAGCTTGGGGAATGGATGTCATCAGTTCTATAGAGTCTACCGCTTCTAATG
GACATAGATTCATTTTGGTTGCCATTGATTATTTCACCAAGTGGGTGGAAGCAACCCCTTACAAGTCGGTAACCAAGAAAGTGGTGGTCG
ATTTTGTTCGCAACAATCTGATATGCAGATTTGGAGTTCCAGAATCCATCATTACTGATAACGGGGCAAATCTCAACAGTCATTTGATGA
AACAGATATATGAACAATTTAAGTTATTCATCGAAAGTXCAACTGCTTATCGCCCCCAAATGAACAGAGCTGTAGAAGCCGCCAACAAAA
ATATCAAGAAGATTTTGAGGAAAATGATTGACAAACAGCGGGGTTGGCATGAAATGTTGCCATATGCTTTTCTAGGTTATCGAACGACGG
TCAGAACATCGACTTGGGCTACTCCATACTTGCTAGTATATGGAACAGAGGCAGTCGTGCCTGTTGAAGTCGAGATACCGTCATTGCGGA
TCATCCAAGAAGCTGAATTAAGTAACGCCGAATGGCTTAGCAAACAGATTGATCAACTAGCCTTAATTGATAAGAAGAGAATAGTTGCGT
TTGCCATGGCAAGTTGTACAGACAGAGAXATGACTCGCGCTTTTCACAAAAGAGTAAGAGCCAGGAATTTTGAAGTTGGTCAGTTGGTTC
TTAAGCGTATTTTTCCTCATCAAGACGAGTACAAAGAAAAGTTCGCGCTTACCTGGCAGGGTCCTTACTTGGTTCGTAAAATATTATCGG
GAGGTGCTTTGGGTCTTGTTaGACCCGGAAGGCGATGTATCGCCCAAACCTATCAACTCAGAATCTGXTCAAGAGAATACTATGCCTGAA
ATTTCATTTGGCATTTTTTCGGGTATTCTTGGAAACGATCCGGTTTGCCTGGGATTTATTTCCAAATTTTTATCCCCCCTGGGAAAGGAA
CAACGTTTCGAACCTGAATTCTCCAAAATTGAAAAACTATAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan