ESTScan Details for Unigene SGN-U338328

Score 
-288
Direction 
Reverse
Predicted Peptide Sequence 
LERRFCDARQGGGAYEKPPATAAFLRFLAFDWPFAHMFFPALSPDSVDNRITPLSELIPLAAAERPSAAESVSEEAEERPIRKPPLPAVG
RFINAAGTTGFPTGKRAVSATQLMELAHSLGTPGFTLYASGRMLCGIVTDNNFTQETAMTMITPSSKLTLTKGNKSWSSTAVA
Predicted Coding Sequence 
XCTGXACTTGAGCGTCGATTTTGTGATGCTCGTCAGGGGGGCGGAGCTTATGAAAAACCGCCAGCAACXGCGGCTTTTTTACGGTTCCTG
GCCTTTGACTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCCCTTTGAGTGAGCTGATA
CCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCC
GTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGGAGTTAGCTCAC
TCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCCGTATGTTGTGTGGAATTGTGACGGATAACAATTTCACACAGGAAACAGCT
ATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCACCGCGGTGGCG
Edits in Original Sequence 
(5')XCTGXACTTGAGCGTCGATTTTGTGATGCTCGTCAGGGGGGCGGAGCTTATGAAAAACCGCCAGCAACXGCGGCTTTTTTACGGTT
CCTGGCCTTTGACTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCgCCTTTGAGTGAGC
TGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCC
CCGCgCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGtGAGTT
AGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCtCGTATGTTGTGTGGAATTGTGAgCGGATAACAATTTCACACAG
GAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCACCGCGGTGGCG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan