ESTScan Details for Unigene SGN-U338365

Score 
418
Direction 
Forward
Predicted Peptide Sequence 
MAGSKREGSSPPPVRKNPYEVLSVPGDSSDQKIKSAYKKLALKYHPNKNANNPEASKLFKEVAIPXGVLSDPEKRRQYDMAGFEAIDAKG
TDMEIDLSNLGTVNTMFAPLFTKLGVPIKTTVSANVLKKPLNGTVKIRPLPIGEGLLREKVEKQKAHFFRCNRLPMEKPRGGAWNLKLPS
PPQKKV
Predicted Coding Sequence 
ATGGCGGGTTCAAAAAGGGAGGGGTCATCACCTCCACCTGTAAGGAAAAACCCATATGAGGTATTGTCTGTACCAGGGGATTCTTCTGAT
CAAAAAATTAAAAGTGCTTATAAAAAGCTCGCACTCAAGTATCATCCCAACAAAAATGCTAACAATCCTGAAGCTTCAAAACTCTTCAAA
GAGGTTGCAATTCCTAXGGGGGTTCTATCTGATCCGGAAAAAAGGAGGCAATATGATATGGCAGGTTTTGAGGCTATTGATGCTAAAGGA
ACCGATATGGAAATTGATTTGTCTAATCTGGGAACTGTCAACACAATGTTTGCACCATTGTTCACCAAGTTGGGTGTTCCCATCAAAACA
ACTGTGTCTGCAAATGTTCTTAAAAAACCTTTAAATGGAACTGTCAAAATCCGCCCTCTTCCAATCGGXGAAGGTCTCTTAAGGGAAAAG
GTTGAAAAACAAAAGGCCCATTTTTTTCGGTGTAACCGATTACCAATGGAAAAACCGAGAGGCGGGGCTTGGAATTTAAAGTTACCTTCC
CCACCCCAAAAGAAGGTTTAA
Edits in Original Sequence 
CGATATCCTGTAAATTTCCTCAAAACCCTAATTTTCTCCCTTTTCCAACATCAATAATCAATTCATAATCCTTTTGTTAGATCTCTTGGT
CCAATTTCCAGCTAATTTTTCCATTTTTTGTTAGCTGTAATCCCAAGAAGATGAAAAGTCGATCCAATTCTTTGAATTCCGTGAAAAATC
TGCATAATTCCCCTCAATTTGTTCTCAAACTTTGATGGGTTTTGTGACTTTTCACAAAAAGACTGTTTTTTTTTTTATTGTTTTGGGTCT
GTATAAGTTTCCTCTGCCTGTCTATTTGCAAACAAAAAAGCTATTTGGATGATACACAGCAAGTAGTTTGGAAAAAAAAAAAAAAAGGTT
CTAAAATTAGGGGAGGAAAAAATTGGGCTTATGGCGGGTTCAAAAAGGGAGGGGTCATCACCTCCACCTGTAAGGAAAAACCCATATGAG
GTATTGT
(5')ATGGCGGGTTCAAAAAGGGAGGGGTCATCACCTCCACCTGTAAGGAAAAACCCATATGAGGTATTGTCTGTACCAGGGG
ATTCTTCTGATCAAAAAATTAAAAGTGCTTATAAAAAGCTCGCACTCAAGTATCATCCCAACAAAAATGCTAACAATCCTGAAGCTTCAA
AACTCTTCAAAGAGGTTGCAtATTCCTAXGGGGGTTCTATCTGATCCGGAAAAAAGGAGGCAATATGATATGGCAGGTTTTGAGGCTATT
GATGCTAAAGGAACCGATATGGAAATTGATTTGTCTAATCTGGGAACTGTCAACACAATGTTTGCACCATTGTTCACCAAGTTGGGTGTT
CCCATCAAAACAACTGTGTCTGCAAATGTTCTTAAAAAACCTTTAAATGGAACTGTCAAAATCCGCCCTCTTCCAATCGGXGAAGGTCTC
TTAAGGGAAAAGGTTGAAAAACAAAAGGCCCATTTTTTTCGGTGTAACCGATTACCAATGGAAAAACCGAGAGGCGGGGCTTGGAATTTA
AAGTTACCTTCCCCACCCCAAAAGAAGGTTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan