ESTScan Details for Unigene SGN-U338378

Score 
167
Direction 
Forward
Predicted Peptide Sequence 
MATVTVXNLAVHTAGPEGANNPTYIPTSACEARCSLASRHKMCLRACGTCCTRCNCVPPGTSGNQDLCPCYRDMLTHHGKHKCP
Predicted Coding Sequence 
ATGGCAACGGTGACGGTGAXCAATTTAGCGGTGCACACGGCTGGACCAGAGGGTGCTAACAACCCTACTTACATCCCTACATCAGCATGT
GAGGCAAGATGTAGTCTAGCATCAAGACATAAAATGTGTTTGAGAGCATGTGGGACTTGTTGCACTCGTTGTAATTGTGTGCCTCCAGGC
ACCTCTGGGAACCAAGATCTTTGCCCTTGTTACCGTGACATGCTCACTCATCATGGCAAGCACAAGTGTCCCTAA
Edits in Original Sequence 
GGGAAGCTAATGGCAACGGTGACGGTGACAATTTAGCGGTGCACACGGCTGGACCAGAGGGTGCTAA(5')ATGGCAACGGTGACGGTGA
XCAATTTAGCGGTGCACACGGCTGGACCAGAGGGTGCTAACAACCCTACTTACATCCCTACATCAGCATGTGAGGCAAGATGTAGTCTAG
CATCAAGACATAAAATGTGTTTGAGAGCATGTGGGACTTGTTGCACTCGTTGTAATTGTGTGCCTCCAGGCACCTCTGGGAACCAAGATC
TTTGCCCTTGTTACCGTGACATGCTCACTCATCATGGCAAGCACAAGTGTCCCTAA(3')TTTAAGAAGTGATCAAAAATAAAACGCGAT
AAATTTTAGATGATTTTTAGATATTTTATTTAATTTTTTATCGGCTTGAAAATTTGCGATTTCTTTTGTATCGACCTATATGCGCGATCG
CGTGTTCTAGATGATAAATGTCACTCGTGTAGTCCCTATATCTTTGGCAAGTTTTGTAAGTTGTTACATATCTTATTACTTTTTAACTTT
TTTGTGATATAAATAGTTCAAGTTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan