Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U338380

Score 
-188
Direction 
Reverse
Predicted Peptide Sequence 
MAPKDVFFPFPLESKVFKNGLXVPNWDKHIAIFRPILMIKKGFSDLGPLVKKSVDLTKFNANFNXNIKAYNLPFAIQVGQLLGRAIGMGL
FAITPVGERGMCCKAIKLGNARVFPVITVVKRRPVNCNATHYRANWVPGP
Predicted Coding Sequence 
ATGGCCCCAAAAGACGTTTTTTTCCCATTTCCGTTGGAGTCCAAGGTTTTTAAAAATGGACTTXTTGTTCCAAATTGGGACAAACACATA
GCCATATTTCGGCCTATTCTTATGATTAAAAAGGGATTTTCCGATTTGGGCCCATTGGTTAAAAAATCAGTTGATTTAACAAAATTTAAC
GCGAATTTTAACAAXAATATTAAGGCTTACAATTTGCCATTCGCCATTCAGGTTGGGCAACTGTTGGGAAGGGCGATCGGTATGGGCCTC
TTCGCTATTACGCCAGTTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCATTACXGTTGTA
AAACGACGGCCAGTGAATTGTAATGCGACTCACTATAGGGCGAATTGGGTACCGGGCCCC
Edits in Original Sequence 
AAAGTGTAGATTTTCTGGCATGGGATGAATAATTGATGTTTTTTGTTGCTTCAATAAGTGGGTAACTTCATATAAATGCAAGACCGATTA
TTGAGTCCAAATGTTCCCATGTTGTGAAGATTTTTATTTTACGTGGAAGTCCACCCAATGTCCTTTTTTGAACTCTCG
(5')ATGGCCCC
AAAAGACGTTTTTTTCCCATTTCaCGTTGGAGTCCAAGGTTTTTAAAAATGGACTTXTTGTTCCAAATTGGGACAAACACATAGCCATAT
TTCGGCCTATTCTTATGATTAAAAAGGGATTTTcCCGATTTGGGCCCATTGGTTAAAAAATCAGTTGATTTAACaAAAATTTAACGCGAA
TTTTAACAAXAATATTAAGGCTTACAATTTGCCATTCGCCATTCAGGTTGGGCAACTGTTGGGAAGGGCGATCGGTATGGGCCTCTTCGC
TATTACGCCAGTTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCATTACXGTTGTAAAACG
ACGGCCAGTGAATTGTAATGCGACTCACTATAGGGCGAATTGGGTACCGGGCCCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan