ESTScan Details for Unigene SGN-U338483

Score 
-195
Direction 
Reverse
Predicted Peptide Sequence 
VSGFAPPLTXRVGFFVNVRQGGRSPMGKTAATGAFFRVPGPFVGFLLNMFFPALSPDSVDNGIPAFEELIPLAAAERPSAAESVSEEAEE
RPIRKPPLPAVGRFINAAGTTGFPTGKRAVSATQLMELAHSLGTPGFTLYASGRMLCGIVTDNNFTQETAMTMITPSSKLTLTKGNKSWS
STAVAAAXRTSGSPGLQEFGTREELFQEFQSTKLSISQAFFKKAHRWGSAFPAISVAENEKCLWDAKKRLAVCGDFCVSPNVEGAIISGL
AAAAQCSEVLCRL
Predicted Coding Sequence 
XCCGTTTCGGGTTTCGCCCCCCCTCTGACTTGAAGGGTTGGATTTTTTGTGAATGTTCGTCAAGGGGGGCGGAGCCCTATGGGAAAAACG
GCAGCAACGGGGGCCTTTTTTAGGGTTCCTGGCCCTTTTGTGGGCTTTTTGCTCAACATGTTCTTCCCTGCGTTATCCCCGGATTCTGTG
GATAACGGTATACCCGCCTTTGAGGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAA
GAGCGCCCAATACGCAAACCGCCTCTCCCCGCCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCA
GTGAGCGCAACGCAATTAATGGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCCGTATGTTGTGTGGAATT
GTGACGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGG
AGCTCCACCGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGAAGAACTATTTCAAGAATTT
CAAAGCACAAAGCTCAGTATATCTCAGGCATTCTTTAAGAAAGCTCATCGATGGGGCAGTGCGTTCCCAGCAATAAGCGTAGCAGAAAAT
GAAAAATGCCTTTGGGACGCGAAGAAAAGGCTGGCAGTATGCGGAGACTTTTGTGTTAGTCCAAATGTTGAAGGGGCTATCATTAGTGGC
TTGGCTGCTGCTGCACAATGTTCTGAAGTTCTCTGTCGCTTATAGTAA
Edits in Original Sequence 
(5')XCCGTTTCGGGTTTCGCCCCCCCTCTGACTTGAAGGGTTGGATTTTTTGTGAATGTTCGTCAAGGGGGGCGGAGCCCTATGGGAAA
AACGGCAGCAACGGGGGCCTTTTTTAGGGTTCCTGGCCCTTTTGTGGGCTTTTTGCTCAACATGTTCtTTCCCTGCGTTATCCCCGGATT
CTGTGGATAACGGTATACCCGCCTTTGAGtGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAA
GCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCgCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAA
GCGGGCAGTGAGCGCAACGCAATTAATGtGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCtCGTATGTTG
TGTGGAATTGTGAgCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAA
CAAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGAAGAACTATT
TCAAGAATTTCAAAGCACAAAGCTCAGTATATCTCAGGCATTCTTTAAGAAAGCTCATCGATGGGGCAGTGCGTTCCCAGCAATAAGCGT
AGCAGAAAATGAAAAATGCCTTTGGGACGCGAAGAAAAGGCTGGCAGTATGCGGAGACTTTTGTGTTAGTCCAAATGTTGAAGGGGCTAT
CATTAGTGGCTTGGCTGCTGCTGCACAATGTTCTGAAGTTCTCTGTCGCTTATAGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan