ESTScan Details for Unigene SGN-U338549

Score 
-550
Direction 
Reverse
Predicted Peptide Sequence 
QTVCFPDKAPTVGLNRXGLVPPAQPGRERTYPETGIPTAVSYEKAPRFPKGEKADRYPVSGRVGTGERTRELPGGKPGIFIVLSGFATSD
LSVDFCDARQGGGAYGKTPATAAFLRFLAFCWPFAHMFFPALSPDSVDNRITPLSELIPLAAAERPSAAESVSEEAEERPIRKPPLPAVG
RFINAAGTTGFPTGKRAVSATQLMELAHSLGTPGFTLYASGRMLCGIVTDNNFTQETAXDHDYAKLEINPP
Predicted Coding Sequence 
XXCCAAACCGTATGTTTCCCGGATAAGGCGCCAACGGTTGGGCTTAACCGGGXGGGTTTGGTGCCCCCAGCCCAGCCTGGGAGGGAACGG
ACCTACCCCGAAACTGGGATTCCTACAGCXGTGAGTTATGAGAAAGCCCCCCGCTTCCCGAAGGGAGAAAAGGCGGACAGGTATCCGGTA
AGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAAGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCT
GACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACXGCGGCCTTTTTACGGTTCCTGGCC
TTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCCCTTTGAGTGAGCTGATACCG
CTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCCGTT
GGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGGAGTTAGCTCACTCA
TTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCCGTATGTTGTGTGGAATTGTGACGGATAACAATTTCACACAGGAAACAGCTXAT
GACCATGATTACGCCAAGCTCGAAATTAACCCTCCCTAA
Edits in Original Sequence 
(5')XXCCAAACCGTATGTTTCCCGGATAAGGCGCCAACGGTTcGGGCTTAACCGGGXGGGTTTGGTGCCCCCAGCCCAGCCTGGGAGGG
AACGGACCTACCCCGAAACTGGGATTCCTACAGCXGTGAGTTATGAGAAAGCCCCCCGCTTCCCGAAGGGAGAAAAGGCGGACAGGTATC
CGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAAcGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCC
ACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACXGCGGCCTTTTTACGGTTC
CTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCgCCTTTGAGTGAGCT
GATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCC
CGCgCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGtGAGTTA
GCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCtCGTATGTTGTGTGGAATTGTGAgCGGATAACAATTTCACACAGG
AAACAGCTXATGACCATGATTACGCCAAGCTCGAAATTAACCCTCCCTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan