ESTScan Details for Unigene SGN-U338573

Score 
-204
Direction 
Forward
Predicted Peptide Sequence 
VWLSVSNFVHCLSGRGATPIATMDTMATATILAESTTSGTTTATTGPYPPGDPYPPPGGPYPPPPPCPYPPGXWVSPRAEFLQPGGSTSS
RAAAXGGGAPTLVPFNEGEFRAWRNHGHSCFLCEIVIRSQFHTTYEPEAESVKPGVPNDELTHINCDALTARFPEGKPGVPAALMNRATA
GKSGLRIGRSSASSLTEWEHSVVRLPQAVSPXLKGGNTVITESGDNPGKKNVSKRASKGPGNRKKGPEAGGYSDKAPAPGGSPPKKPRPK
IRGGAKTPTGT
Predicted Coding Sequence 
GTGTGGCTTAGCGTGAGTAACTTTGTCCATTGCCTCAGCGGTAGAGGAGCAACGCCTATAGCAACCATGGACACCATGGCCACAGCAACC
ATACTGGCAGAATCCACCACGTCGGGGACCACCACCGCCACCACGGGGCCGTATCCACCGGGGGATCCATATCCACCACCGGGGGGTCCA
TATCCACCACCACCACCATGTCCGTATCCACCGGGGCXGTGGGTATCCCCTCGTGCCGAATTCCTGCAACCCGGGGGATCCACTAGTTCA
AGAGCGGCCGCCAGXGGCGGTGGAGCTCCAACTTTGGTGCCCTTTAATGAGGGGGAATTTCGAGCTTGGCGTAATCATGGCCATAGCTGT
TTCCTGTGTGAAATTGTTATCCGCTCACAATTCCACACAACATACGAGCCGGAAGCAGAAAGTGTAAAGCCTGGGGTGCCTAATGATGAG
CTAACTCACATTAATTGCGATGCGCTCACTGCCCGCTTTCCAGAAGGGAAACCTGGCGTGCCAGCTGCATTAATGAATCGGGCAACGGCG
GGGAAGAGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGAATGGGAGCACTCGGTCGTCCGGTTGCCGCAAGCGGTATCA
CCTXCACTCAAGGGGGGTAATACGGTTATCACAGAATCCGGGGATAACCCAGGGAAAAAAAATGTGAGCAAAAGGGCCAGCAAAGGGCCA
GGAAACCGTAAAAAGGGCCCCGAGGCGGGGGGTTATTCCGATAAGGCCCCCGCCCCCGGGGGGAGCCCCCCCAAAAAACCCCGGCCTAAA
ATACGAGGGGGGGCAAAAACCCCAACAGGAACTTAA
Edits in Original Sequence 
GGAAAGATGAATATCATAAGTAAAATATGGATACCTTAAAGACTACAACATGGCGTTTTAGGCAAGAGGTTTTTACTAATATTAGGGGAA
GGTCTAAAGGAGAAAGAGCATTGCTAATAATATTACGTAATTGCCATTACAAAAGGCTTAATATAATATACTACGTACTCCACACATAAT
TAATTAATTGTGTGGCTTAGCGTGAGTAACTTTGTCCATTGCCTCAGCGGTAGAGGAGCAACGCCTATAGCAACCATGGACACCATGGCC
ACAGC
(5')GTGTGGCTTAGCGTGAGTAACTTTGTCCATTGCCTCAGCGGTAGAGGAGCAACGCCTATAGCAACCATGGACACCATGGCC
ACAGCAACCATACTGGCAGAATCCACCACGTCGGGGACCACCACCGCCACCACGGGGtCCGTATCCACCGGGGGATCCATATCCACCACC
GGGGGGTCCATATCCACCACCACCACCATGTCCGTATCCACCGGGGCXGTGGGTATCCCCTCGTGCCGAATTCCTGCAACCCGGGGGATC
CACTAGTTCAAGAGCGGCCGCCAGXGGCGGTGGAGCTCCAACTTTGGTGCCCTTTAATGAGGGGGAATTTCGAGCTTGGCGTAATCATGG
CCATAGCTGTTTCCTGTGTGAAATTGTTATCCGCTCACAATTCCACACAACATACGAGCCGGAAGCAGAAAGTGTAAAGCCTGGGGTGCC
TAATGAgTGAGCTAACTCACATTAATTGCGATGCGCTCACTGCCCGCTTTCCAGAAGGGAAACCTGGCGTGCCAGCTGCATTAATGAATC
GGGCAACGcGCGGGGAAGAGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGAATGGGAGCACTCGGTCGTCCGGTTGCCG
CAAGCGGTATCACCTXCACTCAAGGGGGGTAATACGGTTATCACAGAATCCGGGGATAACCCAGGGAAAAAAAATGTGAGCAAAAGGGCC
AGCAAAGGGCCAGGAAACCGTAAAAAGGGCCCCGAGGCGGGGGGTTATTCCGATAAGGCCCCCGCCCCCGGGGGGAGCCCCCCCAAAAAA
CCCCGGCCTAAAATACGAGGGGGGGCAAAAACCCCAACAGGAACTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan