ESTScan Details for Unigene SGN-U338611

Score 
488
Direction 
Forward
Predicted Peptide Sequence 
MGSKEFLFLGILLAIFAMISCETSMKLDDKNDEYHDGYNGIGGYSGDGRGKYNTGYNSPRDKYKYPSEEYKSPGDKYRSPYDKYKPPSDE
YKYSRDKYNFPHDKYKAPRDEYKHAGDNYNPSRDKYKPPSEEYKSPGDKYKSPGDKYRSPYDKYKPPSDEYKYPRDKYKPPNDKYKLEXG
AYNPPIGGHE
Predicted Coding Sequence 
ATGGGTTCCAAGGAATTTCTATTTCTTGGCATTCTTTTGGCTATTTTTGCAATGATAAGCTGTGAGACCTCAATGAAATTGGATGACAAG
AATGATGAATACCATGATGGATATAATGGCATTGGCGGATATTCTGGTGATGGACGTGGCAAATATAATACTGGATATAACTCTCCACGT
GATAAATATAAGTACCCTAGTGAAGAATATAAGTCTCCAGGTGACAAATATAGATCCCCATATGACAAATACAAACCTCCTAGTGATGAG
TACAAATATTCACGTGACAAATATAACTTCCCACATGATAAATATAAGGCTCCTAGAGATGAATATAAACATGCAGGTGACAACTATAAT
CCCTCACGTGATAAATATAAGCCCCCAAGTGAGGAATACAAGTCTCCAGGTGACAAATACAAATCTCCAGGTGACAAATATAGATCCCCA
TATGATAAGTACAAACCCCCTAGTGATGAGTACAAATATCCACGTGACAAATATAAGCCCCCTAATGACAAATACAAGCTTGAAGXTGGT
GCATACAACCCTCCCATTGGTGGCCATGAGTAA
Edits in Original Sequence 
GTAAAGAAGAAAAAAAATGATGGGTTCCAAGGAATTTCTATTTCTTGGCATTCTTTTGGCTATTTTTGCAATGAT(5')ATGGGTTCCAA
GGAATTTCTATTTCTTGGCATTCTTTTGGCTATTTTTGCAATGATAAGCTGTGAGACCTCAATGAAATTGGATGACAAGAATGATGAATA
CCATGATGGATATAATGGCATTGGCGGATATTCTGGTGATGGACGTGGCAAATATAATACTGGATATAACTCTCCACGTGATAAATATAA
GTACCCTAGTGAAGAATATAAGTCTCCAGGTGACAAATATAGATCCCCATATGACAAATACAAACCTCCTAGTGATGAGTACAAATATTC
ACGTGACAAATATAACTTCCCACATGATAAATATAAGGCTCCTAGAGATGAATATAAACATGCAGGTGACAACTATAATCCCTCACGTGA
TAAATATAAGCCCCCAAGTGAGGAATACAAGTCTCCAGGTGACAAATACAAATCTCCAGGTGACAAATATAGATCCCCATATGATAAGTA
CAAACCCCCTAGTGATGAGTACAAATATCCACGTGACAAATATAAGCCCCCTAATGACAAATACAAGcCTTGAAGXTGGTGCATACAACC
CTCCCATTGGTGGCCATGAGTAA(3')GTAGTGGCAAGATGTATGATATAGTAATGGTCTTGCTACTCTAAAATCGTATGAATAAAACAT
CATTCAGTTCATATGTATGGTTGATCATGTAATATTTTGTTGTAAAAATGTAACACAATATACTGTGATAATATATTTTCAATTTTTCCA
TAATGTNTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan