ESTScan Details for Unigene SGN-U338625

Score 
252
Direction 
Forward
Predicted Peptide Sequence 
TAGNGVFAEIIDGEVYKYYCEGEWKKSASGKSVAIINPTTRKIQYKVQACTQEEVNKVMEIAKAEHNIWAKTLLWKRAELLNKASVILKD
H
Predicted Coding Sequence 
ACGGCTGGAAATGGAGTATTTGCAGAAATAATTGATGGAGAAGTGTACAAATATTATTGTGAAGGAGAATGGAAAAAATCAGCTTCTGGA
AAATCTGTTGCTATTATTAATCCTACTACAAGAAAGATACAATACAAAGTTCAAGCATGTACACAAGAAGAGGTGAACAAAGTAATGGAA
ATAGCAAAAGCAGAACATAATATATGGGCTAAAACACTACTATGGAAAAGAGCAGAGTTACTTAATAAGGCATCTGTAATTTTGAAAGAT
CACTAA
Edits in Original Sequence 
GATCCAAAGTAGGAATCCACCATTTTCTCTTCTTAGTCTTTTTTTTTTTAATTATTGTGAAAGGAAGTTTAAAATTTGGTGTAAAAACGG
CTGGAAATGGAGTATTTGCAGAAATAATTGATGGAGAAGTGTACAAATATTATT
(5')ACGGCTGGAAATGGAGTATTTGCAGAAATAAT
TGATGGAGAAGTGTACAAATATTATTGTGAAGGAGAATGGAAAAAATCAGCTTCTGGAAAATCTGTTGCTATTATTAATCCTACTACAAG
AAAGATACAATACAAAGTTCAAGCATGTACACAAGAAGAGGTGAACAAAGTAATGGAAATAGCAAAAGCAGAACATAATATATGGGCTAA
AACACTACTATGGAAAAGAGCAGAGTTACTTAATAAGGCATCTGTAATTTTGAAAGATCACTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan