ESTScan Details for Unigene SGN-U338631

Score 
41
Direction 
Reverse
Predicted Peptide Sequence 
PKATGPFYGFWAFWWPFVHKVFSGYSPDFVDNLLPPLSEVIPLPAAERPSAAESVSEEAEERPIRKPPLPAVGRFINAAGTTGFPTGKRA
VSATQLMELAHSLGTPGFTLYASGRMLCGIVTDNNFTQETAMTMITPSLKLTLTKGXQKLELPRGGGRFRNSGSPGLQEFGTRVFIKQPD
QIMALKEEFEAHAEKAKTLPESTPNENKLIFYGLYKQATIGNVNTSRPGIFNMRDRAKWDAWKAVEGKSPDEAMNDYIPKVKQLLEEGAA
SA
Predicted Coding Sequence 
CCCAAGGCAACGGGGCCTTTTTACGGTTTCTGGGCCTTTTGGTGGCCTTTTGTTCACAAAGTTTTTTCTGGTTATTCCCCTGATTTTGTG
GATAACCTTTTACCGCCCTTGAGTGAGGTGATACCGCTTCCGGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAA
GAGCGCCCAATACGCAAACCGCCTCTCCCCGCCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCA
GTGAGCGCAACGCAATTAATGGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCCGTATGTTGTGTGGAATT
GTGACGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTTGAAATTAACCCTCACTAAAGGGAAXCAAAAGCTG
GAGCTCCCCCGCGGTGGCGGCCGCTTTAGAAATAGTGGATCCCCCGGGCTGCAGGAATTTGGCACGAGGGTTTTTATCAAGCAACCAGAT
CAGATCATGGCTTTGAAGGAGGAATTTGAAGCACATGCTGAGAAAGCTAAGACATTGCCTGAGAGTACCCCCAATGAGAACAAGCTTATT
TTTTACGGACTTTACAAGCAAGCCACTATTGGCAATGTCAACACAAGCCGTCCTGGCATTTTCAACATGAGAGACAGAGCAAAGTGGGAT
GCATGGAAGGCTGTTGAAGGAAAATCCCCCGATGAAGCCATGAACGACTACATCCCCAAGGTGAAACAGTTGCTGGAAGAAGGTGCTGCT
TCAGCATAA
Edits in Original Sequence 
GTTTTTATCAAGCTAACCAGATCAGATCATGGCTTTGAAGGAGGAATTTGAAGCACATGCTGAGAAAGCTAAGACATTGCCTGAGAGT(5')
CCCAAGGCAACgGGGGCCTTTTTACGGTTTCTGGGCCTTTTGGTGGCCTTTTGTTCACAAAGTTTTTTCTgGGTTATTCCCCTGATTT
TGTGGATAACCgTTTTACCGCCCTTGAGTGAGGTGATACCGCTTCCGGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAG
CGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCgCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAG
CGGGCAGTGAGCGCAACGCAATTAATGtGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCtCGTATGTTGT
GTGGAATTGTGAgCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTTGAAATTAACCCTCACTAAAGGGAAX
CAAAAGCTGGAGCTCCCCCGCGGTGGCGGCCGCTTTAGAAATAGTGGATCCCCCGGGCTGCAGGAATTTGGCACGAGGGTTTTTATCAAG
CtAACCAGATCAGATCATGGCTTTGAAGGAGGAATTTGAAGCACATGCTGAGAAAGCTAAGACATTGCCTGAGAGTACCCCCAATGAGAA
CAAGCTTATTTTTTACGGACTTTACAAGCAAGCCACTATTGGCAATGTCAACACAAGCCGTCCTGGCATTTTCAACATGAGAGACAGAGC
AAAGTGGGATGCATGGAAGGCTGTTGAAGGAAAATCCCCCGATGAAGCCATGAACGACTACATCCCCAAGGTGAAACAGTTGCTGGAAGA
AGGTGCTGCTTCAGCATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan