ESTScan Details for Unigene SGN-U338657

Score 
353
Direction 
Forward
Predicted Peptide Sequence 
MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAPEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVI
DAPGHTDFIKNMITGTSHADCAVLIIDSTTGGFEAGISPPPXPTREHALLAFTLGVKQMIAAATRWMLPPPRLPGYVPMKLSRKFLPYLK
KAGYNPDKIPPLSXISGFDGHPMIDPSNNLEWYKGPPPYLRPLDHITEPTKPLRHTPPPFHFRIALLPLGGIGTVPCPVAVHTGGDYTLG
YGCPLLAPPAPNPXTAKLPADNSFPKASFRQRPSRLTHSSAPNRPPTPGRLQDPSKKGYVCPSHFPKTNPGQRARSHISPAPHFX
Predicted Coding Sequence 
ATGGGTAAAGAGAAGATTCATATCAGCATTGTTGTCATTGGACATGTCGACTCTGGAAAGTCGACCACTACTGGTCACTTGATCTACAAG
CTTGGTGGTATTGACAAGCGTGTGATCGAGAGGTTTGAGAAAGAAGCACCTGAGATGAACAAGAGGTCATTCAAGTATGCATGGGTGCTT
GACAAGCTTAAGGCTGAGCGTGAACGTGGTATTACCATTGATATTGCCTTGTGGAAGTTTGAGACCACAAAGTACTACTGCACTGTGATT
GATGCTCCTGGACACACAGATTTCATCAAGAACATGATTACTGGTACCTCTCACGCTGACTGTGCTGTCCTCATCATTGACTCCACAACT
GGTGGTTTCGAAGCTGGTATCTCCCCXCCCCCCXCCCCCACCCGTGAGCACGCATTGCTTGCTTTCACCCTTGGTGTCAAGCAAATGATT
GCTGCTGCAACAAGATGGATGCTACCACCCCCACGACTCCCAGGCTACGTACCCATGAAATTGTCCAGGAAGTTTCTTCCCTACCTCAAG
AAAGCAGGATACAACCCTGACAAAATCCCCCCTTTGTCCXCCATCTCTGGTTTCGACGGACACCCCATGATTGACCCATCAAACAACCTT
GAATGGTACAAGGGCCCCCCCCCTTACTTGAGGCCTCTTGACCACATTACTGAACCCACGAAGCCCCTCAGACACACCCCTCCCCCCTTC
CACTTCAGGATTGCCCTACTACCATTGGGAGGTATTGGAACTGTACCCTGCCCGGTCGCTGTCCACACTGGCGGCGATTACACCCTGGGG
TATGGCTGCCCCCTTTTGGCCCCACCGGCCCCCAACCCCGXGACGGCTAAACTTCCTGCXGACAATAGCTTCCCCAAAGCCTCTTTCAGG
CAACGCCCTTCTCGGCTGACCCACTCTTCGGCCCCCAACCGCCCACCAACCCCTGGXCGCCTACAGGATCCTTCAAAAAAGGGTTACGTT
TGCCCCTCCCACTTCCCCAAGACTAACCCCGGCCAAAGGGCGCGTTCCCACATTTCCCCGGCCCCACACTTTCXX
Edits in Original Sequence 
GGTTATTCTCTATACGCAGCCAGGTGTTTTAGCAAAGCTCAGAAAAGTTTTAAGACATCATGGGTAAAGAGAAGATTCATATCAGCATTG
TTGTCATTGGACATGTCGACTCTGGAAAGTCGACCACTACTGGTCACTTGA
(5')ATGGGTAAAGAGAAGATTCATATCAGCATTGTTGT
CATTGGACATGTCGACTCTGGAAAGTCGACCACTACTGGTCACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATCGAGAGGTT
TGAGAAAGAAGCACCTGAGATGAACAAGAGGTCATTCAAGTATGCATGGGTGCTTGACAAGCTTAAGGCTGAGCGTGAACGTGGTATTAC
CATTGATATTGCCTTGTGGAAGTTTGAGACCACAAAGTACTACTGCACTGTGATTGATGCTCCTGGACACACAGATTTCATCAAGAACAT
GATTACTGGTACCTCTCACGCTGACTGTGCTGTCCTCATCATTGACTCCACAACTGGTGGTTTCGAAGCTGGTATCTCCCCXCCCCCCXC
CCCCACCCGTGAGCACGCATTGCTTGCTTTCACCCTTGGTGTCAAGCAAATGAtTTGCTGCTGCAACAAGATGGATGCTACCACCCCCAC
GtACTCCCAGGCTACGTACCCATGAAATTGTCCAGGAAGTTTCTTCCCTACCTCAAGAAAGCAGGATACAACCCTGACAAAATCCCCCCT
TTGTCCXCCATCTCTGGTTTCGACGGACACCCCATGATTGACCCATCAAAcCAACCTTGAATGGTACAAGGGCCCCCCCCCTTACTTGAG
GCCTCTTGACCACATTACtTGAACCCACGAAGCCCCTCAGACACACCCCTCCCCCCTTCCACTTCAGGATTGCCCTACTACCATTGGGAG
GTATTGGAACTGTACCCTGCCCGGTCGCTGTCCACACTGGCGGCGATTACACCCTGGGGTATGGCTGCCCCCTTTTGGCCCCACCGGCCC
CCAACCCCGXGACGGCTAAACTTCCTGCXGACAATAGCTTCCCCAAAGCCTCTTTCAGGCAACGCCCTTCTCGGCTGACCCACTCTTCGG
CCCCCAACCGCCCACCAACCCCTGGXCGCCTACAGGATCCTTCAAAAAAGGGTTACGTTTGCCCCTCCCACTTCCCCAAGACTAACCCCG
GCCAAAGGGCGCGTTCCCACATTTCCCCGGCCCCACACTTTCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan