ESTScan Details for Unigene SGN-U338658

Score 
501
Direction 
Forward
Predicted Peptide Sequence 
SRVASALEPVDPPGLQEERCSYXDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGYRFLPVLFCVCFNIGVRFAEILTKIDRRSGK
ELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTGAKVTKAAQKKK
Predicted Coding Sequence 
XXCTCCCGTGTGGCGTCCGCTCTAGAACCAGTGGATCCCCCXGGGCTGCAGGAAGAACGTTGCAGTTATAXGGATCTTAAGAGAGGTTAC
GTTGCCTCCAACTCCAAAGATGACCCAGCGAAGGGTGCTGCTAGCTTCACTGCCCAAGTTATCATCATGAACCACCCTGGTCAGATTGGA
TACCGTTTTTTACCAGTGTTATTCTGTGTGTGCTTCAACATTGGTGTCAGATTTGCTGAGATCTTGACCAAGATTGACAGACGTTCTGGT
AAGGAACTTGAGAAGGAGCCCAAGTTTTTGAAGAATGGTGATGCCGGTATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTTGAGACC
TTTGCTGAGTACCCACCATTGGGACGTTTTGCCGTGAGGGACATGCGTCAGACTGTTGCTGTTGGAGTTGTCAAGAACGTCGACAAGAAA
GACCCTACTGGTGCTAAAGTCACCAAGGCTGCCCAAAAGAAGAAGTGA
Edits in Original Sequence 
(5')XXCTCCCGTGTGGCGTCCGCTCTAGAACCAGTGGATCCCCCXGGGCTGCAGGAAGAACGTTGCAGTTATAXGGATCTTAAGAGAGG
TTACGTTGCCTCCAACTCCAAAGATGACCCAGCGAAGGGTGCTGCTAGCTTCACTGCCCAAGTTATCATCATGAACCACCCTGGTCAGAT
TGGATACCGTTTTTTACCAGTGTTATTCTGTGTGTGCTTCAACATTGGTGTCAGATTTGCTGAGATCTTGACCAAGATTGACAGACGTTC
TGGTAAGGAACTTGAGAAGGAGCCCAAGTTTTTGAAGAATGGTGATGCCGGTATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTTGA
GACCTTTGCTGAGTACCCACCATTGGGACGTTTTGCCGTGAGGGACATGCGTCAGACTGTTGCTGTTGGAGTTGTCAAGAACGTCGACAA
GAAAGACCCTACTGGTGCTAAAGTCACCAAGGCTGCCCAAAAGAAGAAGTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan