Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U338659

Score 
1244
Direction 
Forward
Predicted Peptide Sequence 
KRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLA
FTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPS
DWRNQAWYGCDLGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAXVIIMNHPGQIGNGYA
PVLDCHTSHIAVKFAEILTKIDKLQVKELEKXPKFLKNGDAGMVKMIPHKPMGVETFSNTPPWGPFAXEGMKQTVAGGVVKNVTKKTQLV
PGSQAAPKKESKCFYDPDKIIVXFLSFFFFLKPFCICEGHKRISASHPFWEGKFDIFGKILGGEITL
Predicted Coding Sequence 
AAGAGGTCATTCAAGTATGCCTGGGTGCTTGACAAACTTAAGGCTGAACGTGAGCGTGGTATCACTATTGATATTGCTTTGTGGAAGTTT
GAGACCACTAAGTACTACTGCACTGTGATTGATGCCCCCGGACACAGGGACTTTATCAAGAACATGATCACTGGTACCTCCCAGGCTGAC
TGTGCTGTCCTCATTATTGACTCCACCACTGGTGGTTTCGAAGCTGGTATCTCAAAGGATGGTCAGACCCGTGAACATGCATTGCTTGCT
TTCACCCTTGGTGTCAAGCAAATGATCTGCTGCTGTAACAAGATGGATGCTACCACCCCAAAGTACTCAAAGGCTAGGTATGATGAAATC
GTGAAGGAAGTTTCTTCCTACCTCAAGAAGGTTGGTTACAACCCTGACAAAATCCCATTTGTTCCCATCTCTGGTTTTGAAGGAGATAAT
ATGATTGAGAGGTCTACCAACCTCGACTGGTACAAGGGACCAACCCTCCTTGAGGCTCTCGACCAGATTAATGAGCCCAAGAGGCCATCA
GACTGGCGTAATCAAGCCTGGTATGGTTGTGACCTTGGCCCTACTGGTTTGACAACTGAAGTCAAGTCTGTTGAGATGCACCACGAAGCT
CTCCAGGAGGCGCTCCCTGGAGACAATGTTGGGTTCAATGTTAAGAATGTTGCTGTTAAGGATCTTAAGCGTGGTTATGTTGCCTCAAAC
TCCAAGGATGACCCAGCTAAAGGGGCAGCCAGTTTCACTGCCCANGTCATCATCATGAACCATCCTGGCCAGATTGGAAATGGATATGCA
CCAGTGCTTGACTGCCACACTTCCCACATTGCTGTCAAGTTTGCTGAGATCTTGACAAAGATTGACAAGCTTCAGGTAAAGGAACTTGAA
AAGAAXCCTAAATTCTTGAAGAATGGTGATGCTGGTATGGTTAAAATGATCCCCCACAAGCCCATGGGTGTTGAAACCTTTTCCAATACX
CCACCATGGGGTCCTTTTGCTGXTGAAGGAATGAAGCAAACTGTTGCTGGTGGGGTTGTCAAAAATGTTACAAAAAAGACCCAACTGGTG
CCAGGGTCCCAGGCTGCCCCAAAAAAGGAAAGTAAATGCTTTTATGACCCCGATAAAATAATTGTTXTTTTCCTCAGTTTTTTCTTTTTT
TTGAAACCATTTTGCATTTGTGAAGGGCACAAAAGGATTTCCGCTTCTCACCCTTTTTGGGAAGGGAAATTTGACATTTTTGGAAAAATA
CTTGGGGGAGAAATTACTTTG
Edits in Original Sequence 
GGAACAAGAGGTCATTCAAGTATGCCTGGGTGCTTGACAAACTTAAGGCTGAACGTGAGCGTGGTATC(5')AAGAGGTCATTCAAGTAT
GCCTGGGTGCTTGACAAACTTAAGGCTGAACGTGAGCGTGGTATCACTATTGATATTGCTTTGTGGAAGTTTGAGACCACTAAGTACTAC
TGCACTGTGATTGATGCCCCCGGACACAGGGACTTTATCAAGAACATGATCACTGGTACCTCCCAGGCTGACTGTGCTGTCCTCATTATT
GACTCCACCACTGGTGGTTTCGAAGCTGGTATCTCAAAGGATGGTCAGACCCGTGAACATGCATTGCTTGCTTTCACCCTTGGTGTCAAG
CAAATGATCTGCTGCTGTAACAAGATGGATGCTACCACCCCAAAGTACTCAAAGGCTAGGTATGATGAAATCGTGAAGGAAGTTTCTTCC
TACCTCAAGAAGGTTGGTTACAACCCTGACAAAATCCCATTTGTTCCCATCTCTGGTTTTGAAGGAGATAATATGATTGAGAGGTCTACC
AACCTCGACTGGTACAAGGGACCAACCCTCCTTGAGGCTCTCGACCAGATTAATGAGCCCAAGAGGCCATCAGACTGGCGTAATCAAGCC
TGGTATGGTTGTGACCtTTGGCCCTACTGGTTTGACAACTGAAGTCAAGTCTGTTGAGATGCACCACGAAGCTCTCCAGGAGGCGCTCCC
TGGAGACAATGTTGGGTTCAATGTTAAGAATGTTGCTGTTAAGGATCTTAAGCGTGGTTATGTTGCCTCAAACTCCAAGGATGACCCAGC
TAAAGGGGCAGCCAGTTTCACTGCCCANGTCATCATCATGAACCATCCTGGCCAGATTGGAAATGGATATGCACCAGTGCTTGACTGCCA
CACTTCCCACATTGCTGTCAAGTTTGCTGAGATCTTGACAAAGATTGACAAGCgTTCAGGTAAAGGAACTTGAAAAGAAXCCTAAATTCT
TGAAGAATGGTGATGCTGGTATGGTTAAAATGATCCCCCACAAGCCCATGGGTGTTGAAACCTTTTCCAATACXCCACCATGGGGTCCTT
TTGCTGXTGAAGGAATGAAGCAAACTGTTGCTGGTGGGGTTGTCAAAAATGTTACAAAAAAGACCCAACTGGTGCCAGGGTCCCAGGCTG
CCCCAAAAAAGGAAAGTAAATGCTTTTATGACCCCGATAAAATAATTGTTXTTTTCCTCAGTTTTTTCTTTTTTTTGAAACCATTTTGCA
TTTGTGAAGGGCACAAAAGGATTTCCGCTTCTCACCCTTTTTGGGAAGGGAAATTTGACATTTTTGGAAAAATACTTGGGGGAGAAATTA
CTTTG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan