ESTScan Details for Unigene SGN-U338665

Score 
436
Direction 
Forward
Predicted Peptide Sequence 
MGKEKIHISIGVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALGKFXTPKYFCPGI
DAPDTGTF
Predicted Coding Sequence 
ATGGGTAAGGAAAAGATTCACATCAGTATTGGGGTCATTGGTCATGTCGACTCTGGAAAGTCTACTACCACTGGTCACTTGATCTACAAG
CTTGGTGGTATTGACAAGCGTGTTATTGAGAGGTTCGAGAAGGAAGCTGCTGAAATGAACAAGAGGTCATTCAAGTATGCCTGGGTGCTT
GACAAACTTAAGGCTGAACGTGAGCGTGGTATCACTATTGATATTGCTTTGGGGAAGTTTAXAACCCCTAAATACTTCTGCCCTGGGATT
GATGCCCCCGACACGGGGACTTTTTAA
Edits in Original Sequence 
CCATGCTATCAAAAAATCAAAGATTTTTTCTGAAATGAAAAATACAGTAACATTAGTTGACACTTCCTGGTAGCAGATAATCATGCACTC
TCCAATATAAAATTACTCCTACAGAGACTAGAAATCGCACAAGGAAAACACAACATTTTTGCAACCCTGCATACTAGCATATGGTTTTGC
GCAGCCAAGGTTTAGCGAAGCTTTCTTTTTTTCTCTTCCACCTCCAAAGATTCTAAGGCAATATGGGTAAGGAAAAGATTCACATCAGTA
TTGGGGTCATTGGTCATGTCGACTCTGGAAAGTCTACTACCACTGGTCACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTTATTG
AGAGGTTCGAGAAG
(5')ATGGGTAAGGAAAAGATTCACATCAGTATTGGGGTCATTGGTCATGTCGACTCTGGAAAGTCTACTACCACT
GGTCACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTTATTGAGAGGTTCGAGAAGGAAGCTGCTGAAATGAACAAGAGGTCATTC
AAGTATGCCTGGGTGCTTGACAAACTTAAGGCTGAACGTGAGCGTGGTATCACTATTGATATTGCTTTGGGGAAGTTTAXAACCCCTAAA
TACTTCTGCCCTGGGATTGATGCCCCCGACACGGGGACTTTTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan