ESTScan Details for Unigene SGN-U338667

Score 
1078
Direction 
Forward
Predicted Peptide Sequence 
MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVI
DAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIA
VKFAEILTKIDRRSGRDLEKEPKFLKNGDAGMVKMIPTKPMVVEXPLLEYPPFGFVLAVRDMEATTVAVGGLPKNFGQGKNPIWVAKGEP
KAWPX
Predicted Coding Sequence 
ATGGGTAAAGAGAAGATTCACATCAGCATCGTGGTCATTGGTCATGTTGACTCTGGAAAGTCGACTACCACTGGTCACTTGATCTACAAG
CTTGGTGGTATTGACAAGCGTGTTATTGAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTATGCCTGGGTGCTT
GACAAACTTAAGGCAGAACGTGAGCGTGGTATCACCATTGATATTGCTTTGTGGAAGTTTGAGACCACTAAGTACTACTGCACTGTTATT
GATGCCCCTACTGGTTTGACAACTGAAGTCAAGTCTGTAGAGATGCACCACGAAGCTCTCCAGGAGGCACTCCCTGGTGACAATGTTGGG
TTCAATGTTAAGAATGTTGCTGTTAAGGATCTTAAGCGTGGTTATGTTGCCTCAAACTCCAAGGATGACCCAGCCAAGGGGGCAGCCAGC
TTCACTGCCCAGGTCATCATCATGAACCATCCTGGCCAGATTGGAAACGGATATGCCCCTGTGCTCGACTGTCACACTTCACACATTGCT
GTCAAGTTTGCTGAGATCTTGACCAAGATTGACAGGCGTTCAGGAAGGGACCTTGAGAAAGAGCCTAAGTTCTTGAAGAACGGTGATGCT
GGTATGGTTAAAATGATTCCCACCAAGCCCATGGTTGTTGAGGAXCCTTTGCTTGAATACCCTCCATTTGGGTTCGTTTTGGCTGTGAGG
GACATGGAGGCAACAACTGTTGCTGTTGGTGGTTTGCCAAAAAATTTTGGACAAGGAAAGAACCCAATCTGGGTGGCCAAAGGGGAACCA
AAGGCGTGGCCCAXX
Edits in Original Sequence 
GGTTATTTCTCCTCAGCTGTGCCGCATATCGCCTAATTTTTCTTCTCTAAGTTTCTTAGTGTCTCAAGATGGGTAAAGAGAAGATTCACA
TCAGCATCGTGGTCATTGGTCATGTTGACTCTGGAAAGTCGACTACCACTGGTCACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTG
TTATTGAGAGGTTCGAGAA
(5')ATGGGTAAAGAGAAGATTCACATCAGCATCGTGGTCATTGGTCATGTTGACTCTGGAAAGTCGACTA
CCACTGGTCACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTTATTGAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGT
CATTCAAGTATGCCTGGGTGCTTGACAAACTTAAGGCAGAACGTGAGCGTGGTATCACCATTGATATTGCTTTGTGGAAGTTTGAGACCA
CTAAGTACTACTGCACTGTTATTGATGCCCCTACTGGTTTGACAACTGAAGTCAAGTCTGTAGAGATGCACCACGAAGCTCTCCAGGAGG
CACTCCCTGGTGACAATGTTGGGTTCAATGTTAAGAATGTTGCTGTTAAGGATCTTAAGCGTGGTTATGTTGCCTCAAACTCCAAGGATG
ACCCAGCCAAGGGGGCAGCCAGCTTCACTGCCCAGGTCATCATCATGAACCATCCTGGCCAGATTGGAAACGGATATGCCCCTGTGCTCG
ACTGTCACACTTCACACATTGCTGTCAAGTTTGCTGAGATCTTGACCAAGATTGACAGGCGTTCAGGtAAGGGACCTTGAGAAAGAGCCT
AAGTTCTTGAAGAACGGTGATGCTGGTATGGTTAAAATGATTCCCACCAAGCCCATGGTTGTTGAGGAXCCTTTGCTTGAATACCCTCCA
TTTGGGTTCGTTTTGGCTGTGAGGGACATGGAGGCAACAACTGTTGCTGTTcGGTGGTTTGCCAAAAAATTTTGGACAAGGAAAGAACCC
AATCTGGGTGGCCAAAGGGGAACCAAAGGCGTGGCCCAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan