ESTScan Details for Unigene SGN-U338668

Score 
393
Direction 
Reverse
Predicted Peptide Sequence 
KGGPNPFLRGFLARIKWGPKGTFRXKPPPFFPFKGGFKKLGVLEMSPSVGVKKGVINPERVATFGPTGLPPGVKFVEMPPEVLQGALSGD
NVGFNVKNVAVKDFKKVRLPPTXKDDPAKGGASFPAQVIIRTPPGQIGNGYAPVLDSPPSPIAVKFAEILPKIDRRFGKELEKEPKFLKN
GDAGMVKMIPPKPMVVEPFGGYPPLGRFAVRDRGQTVVVGVVKNVDKKAPPGAKVPKGAQKKKGCVFDEILH
Predicted Coding Sequence 
XXTAAAGGGGGCCCCAACCCTTTTTTGAGGGGTTTTTTGGCCCGGATTAAATGGGGCCCCAAGGGGACCTTTAGAXACAAGCCCCCTCCT
TTTTTCCCGTTTAAGGGAGGTTTCAAAAAATTGGGTGTTTTGGAAATGTCCCCTTCGGTTGGGGTTAAAAAGGGGGTTATTAACCCGGAA
AGGGTTGCCACTTTTGGTCCAACTGGTTTGCCCCCCGGGGTTAAATTTGTTGAGATGCCCCCGGAGGTTCTTCAGGGGGCACTTTCTGGG
GACAATGTTGGGTTCAATGTCAAGAACGTTGCAGTTAAGGATTTTAAGAAGGTTAGGTTGCCTCCAACTXTTAAAGATGACCCAGCAAAG
GGGGGTGCCAGCTTCCCTGCTCAAGTTATCATCAGGACCCCCCCTGGTCAGATTGGAAATGGATATGCCCCAGTGTTGGATTCCCCCCCC
TCCCCCATTGCTGTAAAGTTTGCGGAGATTTTGCCCAAGATTGACAGACGTTTTGGTAAGGAACTTGAGAAGGAGCCCAAGTTTTTGAAA
AATGGTGATGCCGGTATGGTTAAGATGATTCCCCCCAAGCCCATGGTTGTTGAGCCCTTTGGTGGGTACCCCCCATTGGGACGTTTTGCT
GTGAGGGACAGGGGTCAGACTGTTGTTGTTGGAGTTGTCAAGAACGTTGACAAGAAAGCCCCTCCTGGGGCTAAAGTCCCCAAGGGTGCC
CAAAAGAAGAAGGGATGTGTTTTTGATGAGATTTTGCATTGA
Edits in Original Sequence 
(5')XXTAAAGGGGGCCCCAACCCTTTTTTGAGGGGTTTTTTGGCCCGGATTAAATGGGGCCCCAAGGGGACCTTTAGAXACAAGCCCCC
TCCTTTTTTCCCGTTTAAGGGAGGTTTCAAAAAATTGGGTGTTTTGGAAATGTCCCCTTCGGTTGGGGTTAAAAAGGGGGTTATTAAgCC
CGGAAAGGGTTGCCACTTTTGGTCCAACTGGTTTGCCCCCCGGGGTTAAATTTGTTGAGATGCCCCCGGAGGTTCTTCAGGGGGCACTTT
CTGGGGACAATGTTGGGTTCAATGTCAAGAACGTTGCAGTTAAGGATTTTAAGAgAGGTTAGGTTGCCTCCAACTXTTAAAGATGACCCA
GCAAAGGGGGGTGCCAGCTTCCCTGCTCAAGTTATCATCAGGACCCCCCCTGGTCAGATTGGAAATGGATATGCCCCAGTGTTGGATTCC
CCCCCCTCCCCCATTGCTGTAAAGTTTGCGGAGATTTTGCCCAAGATTGACAGACGTTTTGGTAAGGAACTTGAGAAGGAGCCCAAGTTT
TTGAAAAATGGTGATGCCGGTATGGTTAAGATGATTCCCCCCAAGCCCATGGTTGTTGAGCCCTTTGGTGGGTACCCCCCATTGGGACGT
TTTGCTGTGAGGGACAGGGGTCAGACTGTTGTTGTTGGAGTTGTCAAGAACGTTGACAAGAAAGCCCCTCCTGGGGCTAAAGTCCCCAAG
GGTGCCCAAAAGAAGAAGGGATGTGTTTTTGATGAGATTTTGCATTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan