Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U338673

Score 
174
Direction 
Forward
Predicted Peptide Sequence 
GPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKVTKAAQKKGKXNCAVDAGVSNAFIYIECAI
Predicted Coding Sequence 
GGCCCTACTGGTTTGACAACTGAAGTCAAGTCTGTAGAGATGCACCACGAAGCTCTCCAGGAGGCACTCCCTGGTGACAATGTTGGGTTC
AATGTTAAGAATGTTGCTGTTAAGGATCTTAAGCGTGGTTATGTTGCCTCAAACTCCAAGGTGACCAAGGCTGCCCAGAAGAAGGGGAAG
XTGAACTGTGCAGTTGATGCTGGTGTTTCGAATGCATTTATTTACATCGAGTGTGCTATCTAG
Edits in Original Sequence 
GGTGACCTTTGGCCCTACTGGTTTGACAACTGAAGTCAAGTCTGTAGAGATGCACCACGAAGCTCTCCAGGAGGCACT(5')GGCCCTAC
TGGTTTGACAACTGAAGTCAAGTCTGTAGAGATGCACCACGAAGCTCTCCAGGAGGCACTCCCTGGTGACAATGTTGGGTTCAATGTTAA
GAATGTTGCTGTTAAGGATCTTAAGCGTGGTTATGTTGCCTCAAACTCCAAGGTGACCAAGGCTGCCCAGAAGAAGGGGAAGXTGAACTG
TGCAGTgTGATGCTGGTGTTTCGAATGCtATTTATTTACATCGAGTGTGCTATCTAG(3')TGTATCTCAAGTATCCATTCTCAGAACTG
GGTACTTGATAGGCGGTGGCGAGCATGATTTTGAGTCTGTTATCATTTGCTTTTGTTGAGGTGCCTTGGTTTGTTTTCCATGGTGGCTCA
GGATTTTTGTTGCTTTAATTTGAGATTTAAGTTTTCTACT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan