ESTScan Details for Unigene SGN-U338683

Score 
-353
Direction 
Forward
Predicted Peptide Sequence 
MVIAVSCVKLLSLTIPHNIRAGSINVKPGVPNDELTHINCVALTARFPVGKPVVPAAINESANAAGRGGLRIGRSSASSLTXLAALGRSA
AAAVSAHSKAVIRLSTESGDNXRKKHVSKRPAKGQETKKAALLAFFHRLPPPDEHPKNPRSHQRGAKPDRTLKKPXAFPPGKPPPGAPPV
SNPCPFTGKLVPPFSPFGKTWGPFPHTSTP
Predicted Coding Sequence 
ATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCCTCACAATTCCACACAACATACGAGCCGGAAGCATAAATGTAAAGCCTGGGGTG
CCTAATGATGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCXATTAATGAA
TCGGCCAACGCXGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGAXCTCGCTGCGCTCGGTCGTTCGGCT
GCGGCGGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACXGCAGGAAAAAACATGTGAGCAAAAGG
CCAGCAAAAGGCCAGGAAACTAAAAAAGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCCCCCCCCTGACGAGCATCCCAAAAATCCACGC
TCACATCAAAGGGGGGCAAAACCCGACAGGACTTTAAAAAAACCAGXGGCGTTTCCCCCTGGAAAGCCCCCTCCGGGCGCTCCTCCGGTT
TCGAACCCCTGCCCCTTTACCGGAAAACTTGTCCCCCCTTTTTCCCCCTTCGGGAAAACGTGGGGGCCTTTTCCTCATACCTCCACGCCT
TAA
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTATTGGAAAAGAACCCTTTATAGAGCTTATAAGTTCACTTGCATTATTATTTATTCCCTTA
ACAGGAACAAAGATAAGGAGAAAGGACCCATAGGCCATCATGGAAAAAAAACTAGATAAATACATCAAGTGAACTGCAAATTATTTCTTC
ATTTGCATCATCAAACTGCAAATTCATAACCCCCGTGATTAACTTGACGACGATTGAGCATCGCAAAATATCCTTG
(5')ATGGTCATAG
CTGTTTCCTGTGTGAAATTGTTATCCgCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAgTGTAAAGCCTGGGGTGCCTAATGA
gTGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCXATTAATGAATCGGCCA
ACGCXGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGAXCTCGCTGCGCTCGGTCGTTCGGCTGCGGCGa
GCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACXGCAGGAAAAAACATGTGAGCAAAAGGCCAGCA
AAAGGCCAGGAAACgTAAAAAAGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCCCCCCCCTGACGAGCATCCCAAAAATCCACGCTCACA
TCAAAGGGGGGCAAAACCCGACAGGACTTTAAAAAAACCAGXGGCGTTTCCCCCTGGAAAGCCCCCTCCGGGCGCTCCTCCGGTTTCGAA
CCCCTGCCCCTTTACCGGAAAACTTGTCCCCCCTTTTTCCCCCTTCGGGAAAACGTGGGGGCCTTTTCCTCATACCTCCACGCCTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan