ESTScan Details for Unigene SGN-U338685

Score 
-301
Direction 
Forward
Predicted Peptide Sequence 
MNRPTPGERRFAYWAALPLPRSLTAALGRSAAAAVSAHSKAVIRLSTESGDNXRKKHVSKRPAKGQEPKKAALLAFFHRLRPPDEHHKNP
XLKSEVAKPDRTIKIPGVSPWKLPRASPVPTLPLTGILPAFLPSGKPGRFLITSRCKESPVPG
Predicted Coding Sequence 
ATGAATCGGCCAACCCCCGGGGAAAGGCGGTTTGCGTATTGGGCXGCTCTTCCGCTTCCTCGCTCACTGACTGCTGCGCTCGGTCGTTCG
GCTGCGGCGGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACXGCAGGAAAAAACATGTGAGCAAA
AGGCCAGCAAAAGGCCAGGAACCTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCCA
CXGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCCTCTCCTGTTCCG
ACCCTGCCGCTTACCGGAATCCTTCCCGCCTTTCTCCCTTCCGGGAAGCCGGGCCGCTTTCTCATAACCTCACGCTGTAAGGAATCTCCA
GTTCCGGGGTAG
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTTTTTTTAACTTATTGTAAAACCACTTTAAAAGTTCTTATAAGTTCACTTGCATTATTATTTCCTCTCAAAC
AGGAACAAAGATAAGGAGAAAGGACCCATAGGCCATCATGGAAAAAAAACTAAATAAATACATCAAGTGAACTGCAAATTAT
(5')ATGA
ATCGGCCAACCCCCGGGGAAAGGCGGTTTGCGTATTGGGCXGCTCTTCCGCTTCCTCGCTCACTGACTcGCTGCGCTCGGTCGTTCGGCT
GCGGCGaGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACXGCAGGAAAAAACATGTGAGCAAAAG
GCCAGCAAAAGGCCAGGAACCgTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCCAC
XGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCgCTCTCCTGTTCCG
ACCCTGCCGCTTACCGGAATCCTgTCCCGCCTTTCTCCCTTCCGGGAAGCCGGGCCGCTTTCTCATAACCTCACGCTGTAAGGAATCTCC
AGTTCCGGGGTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan