ESTScan Details for Unigene SGN-U338700

Score 
229
Direction 
Forward
Predicted Peptide Sequence 
MAQIIYTLKSMHPRDSNSTEQPNILAINPVLLIAVDVVEEGGAPXLRCILVEVDTLVEDNPVGGYPC
Predicted Coding Sequence 
ATGGCACAGATCATTTACACCCTCAAAAGCATGCATCCAAGAGACAGCAACAGCACAGAGCAGCCAAACATCCTTGCXATTAATCCAGTG
CTACTGATTGCTGTTGATGTTGTTGAGGAGGGTGGAGCACCAXTACTGAGGTGCATACTCGTGGAGGTGGATACCCTTGTTGAGGATAAC
CCTGTGGGTGGATACCCTTGCTGA
Edits in Original Sequence 
CAAAGATCAAATTATGGGTCAAAGTAAGTATTGGACAAAACACATAAAGAAAAAAGTCTAGACTATGATATAATTGATTCAATAAACTTT
TGCCATCAACACATGGCACAGATCATTTACACCCTCAAAAGCATGCATCCAAGAGACAGCAACAGCACAGAGCAGCCAAACATCCTTGCA
TTAATCCAGTGCTACTAGATT
(5')ATGGCACAGATCATTTACACCCTCAAAAGCATGCATCCAAGAGACAGCAACAGCACAGAGCAGCC
AAACATCCTTGCXATTAATCCAGTGCTACTaGATTGCTGTTGATGTTGTTGAGGAGGGTGGAGCACCAXTACTGAGGTGCATACTCGTGG
AGGTGGATACCCTTGTTGAGGATAACCCTGTGGGTGGATACCCTTGCTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan